Tan0014367 (gene) Snake gourd v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCTACCTTTCAAATCTCTTTGTTCTCATTTCTCTTCTAGTTCTCGCCTTCTCGCCCATGATAAAATCAATACCCGATATGAAAGGAAGCCTAGCAACACGATTAAAGTTGGAAAACGAGAAACTAGATTGTTGGTCATCTCTATTTAAACTCTACGCATGCACCAACGACATTGCAAAACACTTCATAAACGGTAAAGCCAACATAAATCCAAACTGTTGTCATACGATCAAGATCATTCAACGTGAGTGTTGGCCAACATTACTCAACACCTTTGGATTCACACCAAAAGAAGTCAACATTATTGATGCTAATTGA ATGGCCTACCTTTCAAATCTCTTTGTTCTCATTTCTCTTCTAGTTCTCGCCTTCTCGCCCATGATAAAATCAATACCCGATATGAAAGGAAGCCTAGCAACACGATTAAAGTTGGAAAACGAGAAACTAGATTGTTGGTCATCTCTATTTAAACTCTACGCATGCACCAACGACATTGCAAAACACTTCATAAACGGTAAAGCCAACATAAATCCAAACTGTTGTCATACGATCAAGATCATTCAACGTGAGTGTTGGCCAACATTACTCAACACCTTTGGATTCACACCAAAAGAAGTCAACATTATTGATGCTAATTGA ATGGCCTACCTTTCAAATCTCTTTGTTCTCATTTCTCTTCTAGTTCTCGCCTTCTCGCCCATGATAAAATCAATACCCGATATGAAAGGAAGCCTAGCAACACGATTAAAGTTGGAAAACGAGAAACTAGATTGTTGGTCATCTCTATTTAAACTCTACGCATGCACCAACGACATTGCAAAACACTTCATAAACGGTAAAGCCAACATAAATCCAAACTGTTGTCATACGATCAAGATCATTCAACGTGAGTGTTGGCCAACATTACTCAACACCTTTGGATTCACACCAAAAGAAGTCAACATTATTGATGCTAATTGA MAYLSNLFVLISLLVLAFSPMIKSIPDMKGSLATRLKLENEKLDCWSSLFKLYACTNDIAKHFINGKANINPNCCHTIKIIQRECWPTLLNTFGFTPKEVNIIDAN Homology
BLAST of Tan0014367 vs. ExPASy Swiss-Prot
Match: Q9T039 (Egg cell-secreted protein 1.4 OS=Arabidopsis thaliana OX=3702 GN=EC1.4 PE=2 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.8e-14 Identity = 33/100 (33.00%), Postives = 64/100 (64.00%), Query Frame = 0
BLAST of Tan0014367 vs. ExPASy Swiss-Prot
Match: Q9SRD8 (Egg cell-secreted protein 1.1 OS=Arabidopsis thaliana OX=3702 GN=EC1.1 PE=2 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 3.7e-14 Identity = 36/105 (34.29%), Postives = 61/105 (58.10%), Query Frame = 0
BLAST of Tan0014367 vs. ExPASy Swiss-Prot
Match: Q9SJ24 (Egg cell-secreted protein 1.2 OS=Arabidopsis thaliana OX=3702 GN=EC1.2 PE=2 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 3.1e-13 Identity = 33/100 (33.00%), Postives = 61/100 (61.00%), Query Frame = 0
BLAST of Tan0014367 vs. ExPASy Swiss-Prot
Match: Q9SJ23 (Egg cell-secreted protein 1.3 OS=Arabidopsis thaliana OX=3702 GN=EC1.3 PE=2 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 5.3e-13 Identity = 34/100 (34.00%), Postives = 59/100 (59.00%), Query Frame = 0
BLAST of Tan0014367 vs. NCBI nr
Match: KGN46138.1 (hypothetical protein Csa_005151 [Cucumis sativus]) HSP 1 Score: 122.5 bits (306), Expect = 2.2e-24 Identity = 54/103 (52.43%), Postives = 75/103 (72.82%), Query Frame = 0
BLAST of Tan0014367 vs. NCBI nr
Match: XP_023524587.1 (egg cell-secreted protein 1.1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 112.8 bits (281), Expect = 1.8e-21 Identity = 52/105 (49.52%), Postives = 72/105 (68.57%), Query Frame = 0
BLAST of Tan0014367 vs. NCBI nr
Match: XP_022998659.1 (egg cell-secreted protein 1.1-like [Cucurbita maxima]) HSP 1 Score: 111.7 bits (278), Expect = 3.9e-21 Identity = 53/105 (50.48%), Postives = 72/105 (68.57%), Query Frame = 0
BLAST of Tan0014367 vs. NCBI nr
Match: KAG6607143.1 (Egg cell-secreted protein 1.1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 111.7 bits (278), Expect = 3.9e-21 Identity = 51/105 (48.57%), Postives = 72/105 (68.57%), Query Frame = 0
BLAST of Tan0014367 vs. NCBI nr
Match: KAA0054959.1 (egg cell-secreted protein 1.2-like [Cucumis melo var. makuwa] >TYK22748.1 egg cell-secreted protein 1.2-like [Cucumis melo var. makuwa]) HSP 1 Score: 107.8 bits (268), Expect = 5.7e-20 Identity = 44/83 (53.01%), Postives = 62/83 (74.70%), Query Frame = 0
BLAST of Tan0014367 vs. ExPASy TrEMBL
Match: A0A0A0K9I7 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G056550 PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 1.1e-24 Identity = 54/103 (52.43%), Postives = 75/103 (72.82%), Query Frame = 0
BLAST of Tan0014367 vs. ExPASy TrEMBL
Match: A0A6J1KEX2 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493240 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 1.9e-21 Identity = 53/105 (50.48%), Postives = 72/105 (68.57%), Query Frame = 0
BLAST of Tan0014367 vs. ExPASy TrEMBL
Match: A0A5A7UNB2 (Egg cell-secreted protein 1.2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1163G00780 PE=4 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 2.7e-20 Identity = 44/83 (53.01%), Postives = 62/83 (74.70%), Query Frame = 0
BLAST of Tan0014367 vs. ExPASy TrEMBL
Match: A0A6J1KD37 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493241 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 4.7e-20 Identity = 50/105 (47.62%), Postives = 69/105 (65.71%), Query Frame = 0
BLAST of Tan0014367 vs. ExPASy TrEMBL
Match: A0A1S3CM80 (egg cell-secreted protein 1.2-like OS=Cucumis melo OX=3656 GN=LOC103502392 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 2.3e-19 Identity = 50/106 (47.17%), Postives = 69/106 (65.09%), Query Frame = 0
BLAST of Tan0014367 vs. TAIR 10
Match: AT4G39340.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 79.3 bits (194), Expect = 2.0e-15 Identity = 33/100 (33.00%), Postives = 64/100 (64.00%), Query Frame = 0
BLAST of Tan0014367 vs. TAIR 10
Match: AT1G76750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 79.0 bits (193), Expect = 2.6e-15 Identity = 36/105 (34.29%), Postives = 61/105 (58.10%), Query Frame = 0
BLAST of Tan0014367 vs. TAIR 10
Match: AT2G21740.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 75.9 bits (185), Expect = 2.2e-14 Identity = 33/100 (33.00%), Postives = 61/100 (61.00%), Query Frame = 0
BLAST of Tan0014367 vs. TAIR 10
Match: AT2G21750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 75.1 bits (183), Expect = 3.8e-14 Identity = 34/100 (34.00%), Postives = 59/100 (59.00%), Query Frame = 0
BLAST of Tan0014367 vs. TAIR 10
Match: AT3G48675.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 50.8 bits (120), Expect = 7.7e-07 Identity = 31/94 (32.98%), Postives = 48/94 (51.06%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Snake gourd (anguina) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|