Tan0002915 (gene) Snake gourd v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGACAGTTTTATGGAAAGAGTTCTTGCAATGGAACTCTCCTGTCCCGTATATCTTTGGAGGCTTTGCCATTGTTTTTGGAATCACTTCTGCTGTTCTTTTTATCCTTGTTTGCTCTCACCAAATGCGGACGCTAAATTCTACTATCAACGATGACAAAGAGAAGGCAAGCACGAACACGGGCAGTGAGGAGCTTGATGCTACTCCAAGTATAGCTGTAATCATGGCTGGGGATGATCATCCCAGGTACATGGCAAAGCCTGTCTCTTTTATTGGGAATTAG ATGACAGTTTTATGGAAAGAGTTCTTGCAATGGAACTCTCCTGTCCCGTATATCTTTGGAGGCTTTGCCATTGTTTTTGGAATCACTTCTGCTGTTCTTTTTATCCTTGTTTGCTCTCACCAAATGCGGACGCTAAATTCTACTATCAACGATGACAAAGAGAAGGCAAGCACGAACACGGGCAGTGAGGAGCTTGATGCTACTCCAAGTATAGCTGTAATCATGGCTGGGGATGATCATCCCAGGTACATGGCAAAGCCTGTCTCTTTTATTGGGAATTAG ATGACAGTTTTATGGAAAGAGTTCTTGCAATGGAACTCTCCTGTCCCGTATATCTTTGGAGGCTTTGCCATTGTTTTTGGAATCACTTCTGCTGTTCTTTTTATCCTTGTTTGCTCTCACCAAATGCGGACGCTAAATTCTACTATCAACGATGACAAAGAGAAGGCAAGCACGAACACGGGCAGTGAGGAGCTTGATGCTACTCCAAGTATAGCTGTAATCATGGCTGGGGATGATCATCCCAGGTACATGGCAAAGCCTGTCTCTTTTATTGGGAATTAG MTVLWKEFLQWNSPVPYIFGGFAIVFGITSAVLFILVCSHQMRTLNSTINDDKEKASTNTGSEELDATPSIAVIMAGDDHPRYMAKPVSFIGN Homology
BLAST of Tan0002915 vs. ExPASy Swiss-Prot
Match: Q8S8A0 (Protein GLUTAMINE DUMPER 4 OS=Arabidopsis thaliana OX=3702 GN=GDU4 PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 7.7e-08 Identity = 34/86 (39.53%), Postives = 48/86 (55.81%), Query Frame = 0
BLAST of Tan0002915 vs. ExPASy Swiss-Prot
Match: O81775 (Protein GLUTAMINE DUMPER 1 OS=Arabidopsis thaliana OX=3702 GN=GDU1 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.8e-07 Identity = 33/83 (39.76%), Postives = 46/83 (55.42%), Query Frame = 0
BLAST of Tan0002915 vs. ExPASy Swiss-Prot
Match: Q3E965 (Protein GLUTAMINE DUMPER 5 OS=Arabidopsis thaliana OX=3702 GN=GDU5 PE=2 SV=2) HSP 1 Score: 52.0 bits (123), Expect = 4.2e-06 Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 0
BLAST of Tan0002915 vs. ExPASy Swiss-Prot
Match: Q3EAV6 (Protein GLUTAMINE DUMPER 6 OS=Arabidopsis thaliana OX=3702 GN=GDU6 PE=2 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 4.2e-06 Identity = 30/81 (37.04%), Postives = 47/81 (58.02%), Query Frame = 0
BLAST of Tan0002915 vs. ExPASy Swiss-Prot
Match: Q9SW07 (Protein GLUTAMINE DUMPER 2 OS=Arabidopsis thaliana OX=3702 GN=GDU2 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 9.5e-06 Identity = 27/83 (32.53%), Postives = 42/83 (50.60%), Query Frame = 0
BLAST of Tan0002915 vs. NCBI nr
Match: KGN63754.1 (hypothetical protein Csa_013545 [Cucumis sativus]) HSP 1 Score: 153.7 bits (387), Expect = 7.9e-34 Identity = 74/93 (79.57%), Postives = 82/93 (88.17%), Query Frame = 0
BLAST of Tan0002915 vs. NCBI nr
Match: KAA0058027.1 (protein GLUTAMINE DUMPER 5 [Cucumis melo var. makuwa] >TYJ98249.1 protein GLUTAMINE DUMPER 5 [Cucumis melo var. makuwa]) HSP 1 Score: 150.2 bits (378), Expect = 8.7e-33 Identity = 71/93 (76.34%), Postives = 81/93 (87.10%), Query Frame = 0
BLAST of Tan0002915 vs. NCBI nr
Match: KAG7023267.1 (hypothetical protein SDJN02_14292, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 87.0 bits (214), Expect = 9.1e-14 Identity = 40/53 (75.47%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of Tan0002915 vs. NCBI nr
Match: TYJ42442.1 (hypothetical protein E1A91_A03G089900v1 [Gossypium mustelinum]) HSP 1 Score: 81.3 bits (199), Expect = 5.0e-12 Identity = 41/82 (50.00%), Postives = 50/82 (60.98%), Query Frame = 0
BLAST of Tan0002915 vs. NCBI nr
Match: TXG51565.1 (hypothetical protein EZV62_024089 [Acer yangbiense]) HSP 1 Score: 81.3 bits (199), Expect = 5.0e-12 Identity = 38/78 (48.72%), Postives = 50/78 (64.10%), Query Frame = 0
BLAST of Tan0002915 vs. ExPASy TrEMBL
Match: A0A0A0LRW3 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G014510 PE=3 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 3.8e-34 Identity = 74/93 (79.57%), Postives = 82/93 (88.17%), Query Frame = 0
BLAST of Tan0002915 vs. ExPASy TrEMBL
Match: A0A5D3BGT8 (Protein GLUTAMINE DUMPER 5 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold346G00210 PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 4.2e-33 Identity = 71/93 (76.34%), Postives = 81/93 (87.10%), Query Frame = 0
BLAST of Tan0002915 vs. ExPASy TrEMBL
Match: A0A5B7APQ2 (Putative Glutamine dumper 2 OS=Davidia involucrata OX=16924 GN=Din_028213 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 6.3e-13 Identity = 43/87 (49.43%), Postives = 56/87 (64.37%), Query Frame = 0
BLAST of Tan0002915 vs. ExPASy TrEMBL
Match: A0A5C7H4D5 (Uncharacterized protein OS=Acer yangbiense OX=1000413 GN=EZV62_024089 PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 2.4e-12 Identity = 38/78 (48.72%), Postives = 50/78 (64.10%), Query Frame = 0
BLAST of Tan0002915 vs. ExPASy TrEMBL
Match: A0A5D2ZUT7 (Uncharacterized protein OS=Gossypium mustelinum OX=34275 GN=E1A91_A03G089900v1 PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 2.4e-12 Identity = 41/82 (50.00%), Postives = 50/82 (60.98%), Query Frame = 0
BLAST of Tan0002915 vs. TAIR 10
Match: AT2G24762.1 (glutamine dumper 4 ) HSP 1 Score: 57.8 bits (138), Expect = 5.5e-09 Identity = 34/86 (39.53%), Postives = 48/86 (55.81%), Query Frame = 0
BLAST of Tan0002915 vs. TAIR 10
Match: AT4G31730.1 (glutamine dumper 1 ) HSP 1 Score: 55.5 bits (132), Expect = 2.7e-08 Identity = 33/83 (39.76%), Postives = 46/83 (55.42%), Query Frame = 0
BLAST of Tan0002915 vs. TAIR 10
Match: AT3G30725.1 (glutamine dumper 6 ) HSP 1 Score: 52.0 bits (123), Expect = 3.0e-07 Identity = 30/81 (37.04%), Postives = 47/81 (58.02%), Query Frame = 0
BLAST of Tan0002915 vs. TAIR 10
Match: AT5G24920.1 (glutamine dumper 5 ) HSP 1 Score: 52.0 bits (123), Expect = 3.0e-07 Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 0
BLAST of Tan0002915 vs. TAIR 10
Match: AT4G25760.1 (glutamine dumper 2 ) HSP 1 Score: 50.8 bits (120), Expect = 6.7e-07 Identity = 27/83 (32.53%), Postives = 42/83 (50.60%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Snake gourd (anguina) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|