Spg019644 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCTCTTCTCCTTGTCGTCGTGCCGCTGTCGATGGCAGCGAGGAAGCCGTTAGGCTTGGACGGTGGCTATGAACCGATAAAGAACATAGCTGACCCACAGATCCAAAGCATAGGAGAGTTCGCAGTGAACGAGCACAATAAGCAAGCCAAGACTGAACTGAAATTCCAGAAAGTGATTAGTGGGTTTCTCCAGTATGTAGCCGGGACCAACTACAAGCTCCAATTAACGGCCCTTGATGGGACTGTAAGCCGCACCTATGTCGCTGTGGTGTACAAAGACCTCAGCGGCAAGAACCAGCTCCTCTCCTTCTTTGGCATCTCCAACTAA ATGGCTTCTCTTCTCCTTGTCGTCGTGCCGCTGTCGATGGCAGCGAGGAAGCCGTTAGGCTTGGACGGTGGCTATGAACCGATAAAGAACATAGCTGACCCACAGATCCAAAGCATAGGAGAGTTCGCAGTGAACGAGCACAATAAGCAAGCCAAGACTGAACTGAAATTCCAGAAAGTGATTAGTGGGTTTCTCCAGTATGTAGCCGGGACCAACTACAAGCTCCAATTAACGGCCCTTGATGGGACTGTAAGCCGCACCTATGTCGCTGTGGTGTACAAAGACCTCAGCGGCAAGAACCAGCTCCTCTCCTTCTTTGGCATCTCCAACTAA ATGGCTTCTCTTCTCCTTGTCGTCGTGCCGCTGTCGATGGCAGCGAGGAAGCCGTTAGGCTTGGACGGTGGCTATGAACCGATAAAGAACATAGCTGACCCACAGATCCAAAGCATAGGAGAGTTCGCAGTGAACGAGCACAATAAGCAAGCCAAGACTGAACTGAAATTCCAGAAAGTGATTAGTGGGTTTCTCCAGTATGTAGCCGGGACCAACTACAAGCTCCAATTAACGGCCCTTGATGGGACTGTAAGCCGCACCTATGTCGCTGTGGTGTACAAAGACCTCAGCGGCAAGAACCAGCTCCTCTCCTTCTTTGGCATCTCCAACTAA MASLLLVVVPLSMAARKPLGLDGGYEPIKNIADPQIQSIGEFAVNEHNKQAKTELKFQKVISGFLQYVAGTNYKLQLTALDGTVSRTYVAVVYKDLSGKNQLLSFFGISN Homology
BLAST of Spg019644 vs. NCBI nr
Match: TYK30896.1 (cysteine proteinase inhibitor 1 [Cucumis melo var. makuwa]) HSP 1 Score: 146.0 bits (367), Expect = 1.9e-31 Identity = 79/112 (70.54%), Postives = 90/112 (80.36%), Query Frame = 0
BLAST of Spg019644 vs. NCBI nr
Match: XP_038895825.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 144.4 bits (363), Expect = 5.7e-31 Identity = 76/112 (67.86%), Postives = 89/112 (79.46%), Query Frame = 0
BLAST of Spg019644 vs. NCBI nr
Match: XP_004151251.1 (cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 141.0 bits (354), Expect = 6.3e-30 Identity = 76/112 (67.86%), Postives = 88/112 (78.57%), Query Frame = 0
BLAST of Spg019644 vs. NCBI nr
Match: KAE8652869.1 (hypothetical protein Csa_013019 [Cucumis sativus]) HSP 1 Score: 141.0 bits (354), Expect = 6.3e-30 Identity = 76/112 (67.86%), Postives = 88/112 (78.57%), Query Frame = 0
BLAST of Spg019644 vs. NCBI nr
Match: XP_022927105.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 140.6 bits (353), Expect = 8.2e-30 Identity = 74/111 (66.67%), Postives = 91/111 (81.98%), Query Frame = 0
BLAST of Spg019644 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 86.7 bits (213), Expect = 1.8e-16 Identity = 44/94 (46.81%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of Spg019644 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 83.2 bits (204), Expect = 2.0e-15 Identity = 44/96 (45.83%), Postives = 65/96 (67.71%), Query Frame = 0
BLAST of Spg019644 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 5.9e-15 Identity = 38/89 (42.70%), Postives = 59/89 (66.29%), Query Frame = 0
BLAST of Spg019644 vs. ExPASy Swiss-Prot
Match: Q84WT8 (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 69.3 bits (168), Expect = 3.0e-11 Identity = 39/97 (40.21%), Postives = 63/97 (64.95%), Query Frame = 0
BLAST of Spg019644 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.4e-10 Identity = 42/111 (37.84%), Postives = 64/111 (57.66%), Query Frame = 0
BLAST of Spg019644 vs. ExPASy TrEMBL
Match: A0A5D3E5H4 (Cysteine proteinase inhibitor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G001040 PE=4 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 9.4e-32 Identity = 79/112 (70.54%), Postives = 90/112 (80.36%), Query Frame = 0
BLAST of Spg019644 vs. ExPASy TrEMBL
Match: A0A0A0LYM0 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 3.0e-30 Identity = 76/112 (67.86%), Postives = 88/112 (78.57%), Query Frame = 0
BLAST of Spg019644 vs. ExPASy TrEMBL
Match: A0A6J1EMY2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111434041 PE=4 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 4.0e-30 Identity = 74/111 (66.67%), Postives = 91/111 (81.98%), Query Frame = 0
BLAST of Spg019644 vs. ExPASy TrEMBL
Match: A0A5A7T201 (Cysteine proteinase inhibitor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold285G003390 PE=4 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 1.5e-29 Identity = 70/97 (72.16%), Postives = 80/97 (82.47%), Query Frame = 0
BLAST of Spg019644 vs. ExPASy TrEMBL
Match: A0A6J1IJX9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475533 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 5.7e-29 Identity = 72/112 (64.29%), Postives = 89/112 (79.46%), Query Frame = 0
BLAST of Spg019644 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 86.7 bits (213), Expect = 1.3e-17 Identity = 44/94 (46.81%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of Spg019644 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 69.3 bits (168), Expect = 2.2e-12 Identity = 39/97 (40.21%), Postives = 63/97 (64.95%), Query Frame = 0
BLAST of Spg019644 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 52.8 bits (125), Expect = 2.1e-07 Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 0
BLAST of Spg019644 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 52.4 bits (124), Expect = 2.7e-07 Identity = 33/95 (34.74%), Postives = 51/95 (53.68%), Query Frame = 0
BLAST of Spg019644 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 44.7 bits (104), Expect = 5.7e-05 Identity = 22/59 (37.29%), Postives = 35/59 (59.32%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|