Sgr017324 (gene) Monk fruit (Qingpiguo) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATATTCGGCGGGAACAAGACGATCCAGATAGTAGGCTTATCCAGAAATCTGTTGGAGTTTAACTTATCGGAGGTTGTGTTTCCTCAGAGCCTGACTTCGCTGGATCTTAACCATAACAAGATCTTTGGGAGTATTCCGGCGGAGGTGACCAAACTGGATTTCCAGTACTTGAATGTGAGTTACAATAGGCTGTGCGGTGAGATTCCGGTGGGTGGGCGGTTGCAGAGCTTCGATCTCTATTCATATTTTCACAACAAGTGTTTGTGCGGTGCACCACTTGGCAGCTGCAAATGA ATGATATTCGGCGGGAACAAGACGATCCAGATAGTAGGCTTATCCAGAAATCTGTTGGAGTTTAACTTATCGGAGGTTGTGTTTCCTCAGAGCCTGACTTCGCTGGATCTTAACCATAACAAGATCTTTGGGAGTATTCCGGCGGAGGTGACCAAACTGGATTTCCAGTACTTGAATGTGAGTTACAATAGGCTGTGCGGTGAGATTCCGGTGGGTGGGCGGTTGCAGAGCTTCGATCTCTATTCATATTTTCACAACAAGTGTTTGTGCGGTGCACCACTTGGCAGCTGCAAATGA ATGATATTCGGCGGGAACAAGACGATCCAGATAGTAGGCTTATCCAGAAATCTGTTGGAGTTTAACTTATCGGAGGTTGTGTTTCCTCAGAGCCTGACTTCGCTGGATCTTAACCATAACAAGATCTTTGGGAGTATTCCGGCGGAGGTGACCAAACTGGATTTCCAGTACTTGAATGTGAGTTACAATAGGCTGTGCGGTGAGATTCCGGTGGGTGGGCGGTTGCAGAGCTTCGATCTCTATTCATATTTTCACAACAAGTGTTTGTGCGGTGCACCACTTGGCAGCTGCAAATGA MIFGGNKTIQIVGLSRNLLEFNLSEVVFPQSLTSLDLNHNKIFGSIPAEVTKLDFQYLNVSYNRLCGEIPVGGRLQSFDLYSYFHNKCLCGAPLGSCK Homology
BLAST of Sgr017324 vs. NCBI nr
Match: XP_022151656.1 (polygalacturonase inhibitor-like, partial [Momordica charantia]) HSP 1 Score: 189.5 bits (480), Expect = 1.4e-44 Identity = 87/98 (88.78%), Postives = 92/98 (93.88%), Query Frame = 0
BLAST of Sgr017324 vs. NCBI nr
Match: XP_022151649.1 (polygalacturonase inhibitor-like [Momordica charantia]) HSP 1 Score: 184.1 bits (466), Expect = 5.8e-43 Identity = 85/98 (86.73%), Postives = 89/98 (90.82%), Query Frame = 0
BLAST of Sgr017324 vs. NCBI nr
Match: XP_023517351.1 (polygalacturonase inhibitor-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 183.7 bits (465), Expect = 7.5e-43 Identity = 82/98 (83.67%), Postives = 89/98 (90.82%), Query Frame = 0
BLAST of Sgr017324 vs. NCBI nr
Match: KAG6595658.1 (Polygalacturonase inhibitor, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 183.3 bits (464), Expect = 9.8e-43 Identity = 83/98 (84.69%), Postives = 89/98 (90.82%), Query Frame = 0
BLAST of Sgr017324 vs. NCBI nr
Match: ARM53421.1 (pgip2 [Momordica charantia]) HSP 1 Score: 182.2 bits (461), Expect = 2.2e-42 Identity = 84/98 (85.71%), Postives = 89/98 (90.82%), Query Frame = 0
BLAST of Sgr017324 vs. ExPASy Swiss-Prot
Match: Q05091 (Polygalacturonase inhibitor OS=Pyrus communis OX=23211 GN=PGIP PE=1 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 3.0e-42 Identity = 79/98 (80.61%), Postives = 89/98 (90.82%), Query Frame = 0
BLAST of Sgr017324 vs. ExPASy Swiss-Prot
Match: A7PW81 (Polygalacturonase inhibitor OS=Vitis vinifera OX=29760 GN=pgip PE=1 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 3.2e-36 Identity = 69/98 (70.41%), Postives = 81/98 (82.65%), Query Frame = 0
BLAST of Sgr017324 vs. ExPASy Swiss-Prot
Match: Q9M5J9 (Polygalacturonase inhibitor 1 OS=Arabidopsis thaliana OX=3702 GN=PGIP1 PE=1 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 2.4e-31 Identity = 59/98 (60.20%), Postives = 75/98 (76.53%), Query Frame = 0
BLAST of Sgr017324 vs. ExPASy Swiss-Prot
Match: Q9M5J8 (Polygalacturonase inhibitor 2 OS=Arabidopsis thaliana OX=3702 GN=PGIP2 PE=2 SV=2) HSP 1 Score: 133.7 bits (335), Expect = 1.2e-30 Identity = 61/98 (62.24%), Postives = 75/98 (76.53%), Query Frame = 0
BLAST of Sgr017324 vs. ExPASy Swiss-Prot
Match: Q9LH52 (Leucine-rich repeat protein FLOR 1 OS=Arabidopsis thaliana OX=3702 GN=FLR1 PE=1 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.1e-23 Identity = 51/97 (52.58%), Postives = 67/97 (69.07%), Query Frame = 0
BLAST of Sgr017324 vs. ExPASy TrEMBL
Match: A0A6J1DFB7 (polygalacturonase inhibitor-like OS=Momordica charantia OX=3673 GN=LOC111019570 PE=4 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 6.6e-45 Identity = 87/98 (88.78%), Postives = 92/98 (93.88%), Query Frame = 0
BLAST of Sgr017324 vs. ExPASy TrEMBL
Match: A0A6J1DDN9 (polygalacturonase inhibitor-like OS=Momordica charantia OX=3673 GN=LOC111019558 PE=4 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 2.8e-43 Identity = 85/98 (86.73%), Postives = 89/98 (90.82%), Query Frame = 0
BLAST of Sgr017324 vs. ExPASy TrEMBL
Match: A0A1W6IYI7 (Pgip2 OS=Momordica charantia OX=3673 PE=2 SV=1) HSP 1 Score: 182.2 bits (461), Expect = 1.1e-42 Identity = 84/98 (85.71%), Postives = 89/98 (90.82%), Query Frame = 0
BLAST of Sgr017324 vs. ExPASy TrEMBL
Match: A0A6J1HTN4 (polygalacturonase inhibitor-like OS=Cucurbita maxima OX=3661 GN=LOC111466052 PE=4 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 4.0e-42 Identity = 81/98 (82.65%), Postives = 88/98 (89.80%), Query Frame = 0
BLAST of Sgr017324 vs. ExPASy TrEMBL
Match: A0A5D3CYT3 (Polygalacturonase inhibitor-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold21G004960 PE=4 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 6.9e-42 Identity = 82/98 (83.67%), Postives = 87/98 (88.78%), Query Frame = 0
BLAST of Sgr017324 vs. TAIR 10
Match: AT5G06860.1 (polygalacturonase inhibiting protein 1 ) HSP 1 Score: 136.0 bits (341), Expect = 1.7e-32 Identity = 59/98 (60.20%), Postives = 75/98 (76.53%), Query Frame = 0
BLAST of Sgr017324 vs. TAIR 10
Match: AT5G06870.1 (polygalacturonase inhibiting protein 2 ) HSP 1 Score: 133.7 bits (335), Expect = 8.3e-32 Identity = 61/98 (62.24%), Postives = 75/98 (76.53%), Query Frame = 0
BLAST of Sgr017324 vs. TAIR 10
Match: AT3G12145.1 (Leucine-rich repeat (LRR) family protein ) HSP 1 Score: 110.5 bits (275), Expect = 7.5e-25 Identity = 51/97 (52.58%), Postives = 67/97 (69.07%), Query Frame = 0
BLAST of Sgr017324 vs. TAIR 10
Match: AT5G12940.1 (Leucine-rich repeat (LRR) family protein ) HSP 1 Score: 80.9 bits (198), Expect = 6.4e-16 Identity = 40/93 (43.01%), Postives = 58/93 (62.37%), Query Frame = 0
BLAST of Sgr017324 vs. TAIR 10
Match: AT1G33610.1 (Leucine-rich repeat (LRR) family protein ) HSP 1 Score: 74.7 bits (182), Expect = 4.6e-14 Identity = 35/84 (41.67%), Postives = 50/84 (59.52%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Monk fruit (Qingpiguo) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|