Pay0008308 (gene) Melon (Payzawat) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAACTCCTTGCTCAAACTCAAGCCGAAATCATAAGGCAACGGCAGACTACGACGCAATCGAATGACACCACGGAAGGCGAGGAAACTTCTTCTGCTGTCATGACGGTCGCTTACAAAGTGAAGGATAATGAAGCCGGCGGGTCGTACTGTTGTTGTGCCATATGCATTGAAGAGTTTGAGGATGAAGAGATTTGTGGAGTTGTTGAGAGTTGTGGCCATTGTTTTCATGAGGATTGTATGGATCAGTGGCTTAGGATTGAGAGCCGTTGCCCATTATGTCGTTGTTTGGTTCATGCTGTATCTCAACAATATTAG ATGCAACTCCTTGCTCAAACTCAAGCCGAAATCATAAGGCAACGGCAGACTACGACGCAATCGAATGACACCACGGAAGGCGAGGAAACTTCTTCTGCTGTCATGACGGTCGCTTACAAAGTGAAGGATAATGAAGCCGGCGGGTCGTACTGTTGTTGTGCCATATGCATTGAAGAGTTTGAGGATGAAGAGATTTGTGGAGTTGTTGAGAGTTGTGGCCATTGTTTTCATGAGGATTGTATGGATCAGTGGCTTAGGATTGAGAGCCGTTGCCCATTATGTCGTTGTTTGGTTCATGCTGTATCTCAACAATATTAG ATGCAACTCCTTGCTCAAACTCAAGCCGAAATCATAAGGCAACGGCAGACTACGACGCAATCGAATGACACCACGGAAGGCGAGGAAACTTCTTCTGCTGTCATGACGGTCGCTTACAAAGTGAAGGATAATGAAGCCGGCGGGTCGTACTGTTGTTGTGCCATATGCATTGAAGAGTTTGAGGATGAAGAGATTTGTGGAGTTGTTGAGAGTTGTGGCCATTGTTTTCATGAGGATTGTATGGATCAGTGGCTTAGGATTGAGAGCCGTTGCCCATTATGTCGTTGTTTGGTTCATGCTGTATCTCAACAATATTAG MQLLAQTQAEIIRQRQTTTQSNDTTEGEETSSAVMTVAYKVKDNEAGGSYCCCAICIEEFEDEEICGVVESCGHCFHEDCMDQWLRIESRCPLCRCLVHAVSQQY Homology
BLAST of Pay0008308 vs. ExPASy Swiss-Prot
Match: Q9LZJ6 (RING-H2 finger protein ATL5 OS=Arabidopsis thaliana OX=3702 GN=ATL5 PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 7.9e-09 Identity = 27/60 (45.00%), Postives = 37/60 (61.67%), Query Frame = 0
BLAST of Pay0008308 vs. ExPASy Swiss-Prot
Match: Q9LSW9 (RING-H2 finger protein ATL16 OS=Arabidopsis thaliana OX=3702 GN=ATL16 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.3e-08 Identity = 22/46 (47.83%), Postives = 32/46 (69.57%), Query Frame = 0
BLAST of Pay0008308 vs. ExPASy Swiss-Prot
Match: O22255 (RING-H2 finger protein ATL64 OS=Arabidopsis thaliana OX=3702 GN=ATL64 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.3e-08 Identity = 23/46 (50.00%), Postives = 31/46 (67.39%), Query Frame = 0
BLAST of Pay0008308 vs. ExPASy Swiss-Prot
Match: Q9C7I1 (RING-H2 finger protein ATL34 OS=Arabidopsis thaliana OX=3702 GN=ATL34 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.3e-08 Identity = 26/56 (46.43%), Postives = 33/56 (58.93%), Query Frame = 0
BLAST of Pay0008308 vs. ExPASy Swiss-Prot
Match: Q8W571 (RING-H2 finger protein ATL32 OS=Arabidopsis thaliana OX=3702 GN=ATL32 PE=2 SV=3) HSP 1 Score: 59.3 bits (142), Expect = 3.0e-08 Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 0
BLAST of Pay0008308 vs. ExPASy TrEMBL
Match: A0A5A7VMH1 (RING-H2 finger protein ATL52-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold352G00560 PE=4 SV=1) HSP 1 Score: 218.0 bits (554), Expect = 1.9e-53 Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 0
BLAST of Pay0008308 vs. ExPASy TrEMBL
Match: A0A5D3BE50 (RING-type E3 ubiquitin transferase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold194G002270 PE=3 SV=1) HSP 1 Score: 215.7 bits (548), Expect = 9.3e-53 Identity = 104/105 (99.05%), Postives = 104/105 (99.05%), Query Frame = 0
BLAST of Pay0008308 vs. ExPASy TrEMBL
Match: A0A1S4E1K2 (RING-type E3 ubiquitin transferase OS=Cucumis melo OX=3656 GN=LOC107991538 PE=3 SV=1) HSP 1 Score: 215.7 bits (548), Expect = 9.3e-53 Identity = 104/105 (99.05%), Postives = 104/105 (99.05%), Query Frame = 0
BLAST of Pay0008308 vs. ExPASy TrEMBL
Match: A0A6J1I5C3 (RING-type E3 ubiquitin transferase OS=Cucurbita maxima OX=3661 GN=LOC111469386 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 1.3e-19 Identity = 55/105 (52.38%), Postives = 72/105 (68.57%), Query Frame = 0
BLAST of Pay0008308 vs. ExPASy TrEMBL
Match: A0A6J1HJU0 (RING-type E3 ubiquitin transferase OS=Cucurbita moschata OX=3662 GN=LOC111464742 PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 6.7e-19 Identity = 54/105 (51.43%), Postives = 71/105 (67.62%), Query Frame = 0
BLAST of Pay0008308 vs. NCBI nr
Match: KAA0067736.1 (RING-H2 finger protein ATL52-like [Cucumis melo var. makuwa]) HSP 1 Score: 218.0 bits (554), Expect = 3.9e-53 Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 0
BLAST of Pay0008308 vs. NCBI nr
Match: TYJ97407.1 (RING-H2 finger protein ATL52-like [Cucumis melo var. makuwa]) HSP 1 Score: 215.7 bits (548), Expect = 1.9e-52 Identity = 104/105 (99.05%), Postives = 104/105 (99.05%), Query Frame = 0
BLAST of Pay0008308 vs. NCBI nr
Match: XP_016902103.1 (PREDICTED: RING-H2 finger protein ATL52-like [Cucumis melo]) HSP 1 Score: 215.7 bits (548), Expect = 1.9e-52 Identity = 104/105 (99.05%), Postives = 104/105 (99.05%), Query Frame = 0
BLAST of Pay0008308 vs. NCBI nr
Match: XP_023520574.1 (RING-H2 finger protein ATL64-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 111.7 bits (278), Expect = 3.9e-21 Identity = 57/105 (54.29%), Postives = 75/105 (71.43%), Query Frame = 0
BLAST of Pay0008308 vs. NCBI nr
Match: KAG6583431.1 (RING-H2 finger protein ATL5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 111.7 bits (278), Expect = 3.9e-21 Identity = 58/105 (55.24%), Postives = 73/105 (69.52%), Query Frame = 0
BLAST of Pay0008308 vs. TAIR 10
Match: AT5G53110.1 (RING/U-box superfamily protein ) HSP 1 Score: 62.8 bits (151), Expect = 1.9e-10 Identity = 21/43 (48.84%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of Pay0008308 vs. TAIR 10
Match: AT3G62690.1 (AtL5 ) HSP 1 Score: 61.2 bits (147), Expect = 5.6e-10 Identity = 27/60 (45.00%), Postives = 37/60 (61.67%), Query Frame = 0
BLAST of Pay0008308 vs. TAIR 10
Match: AT2G47560.1 (RING/U-box superfamily protein ) HSP 1 Score: 60.5 bits (145), Expect = 9.6e-10 Identity = 23/46 (50.00%), Postives = 31/46 (67.39%), Query Frame = 0
BLAST of Pay0008308 vs. TAIR 10
Match: AT5G43420.1 (RING/U-box superfamily protein ) HSP 1 Score: 60.5 bits (145), Expect = 9.6e-10 Identity = 22/46 (47.83%), Postives = 32/46 (69.57%), Query Frame = 0
BLAST of Pay0008308 vs. TAIR 10
Match: AT1G35330.1 (RING/U-box superfamily protein ) HSP 1 Score: 59.7 bits (143), Expect = 1.6e-09 Identity = 26/56 (46.43%), Postives = 33/56 (58.93%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Payzawat) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|