PI0001139 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTACTATCACTAGTTATTTCGGTTTTCTACTAGCAGTTTTAACTATAACCTCAGCTCTATTTATCGGTCTGAACAAGATACGACTTATTTGATTAAAATTAATTGAATGCACAATGAAAAAAAAGAGATTTCGGTCTTATTCAATATATTCTATATATTCTATATTGTAGAGTTCTTTACCTTGTCAATTCAATTTCCAATTCTTGGTCATTGAGATTCATGGGCAATACCGATTAATATTTTAAGGATAGATATTACCTCTCCTTTTCCTCGTTCAACTAAATTGAAATGATTGAAGTTTTTCTATTTGGAATCGTATTAGGTCTAATTCCTATGACTTTGGCTGGATTATTTGTGACCGCATATTTACAATACAGACGGGGGGATCAGTTGGACCTTTGA ATGCCTACTATCACTAGTTATTTCGGTTTTCTACTAGCAGTTTTAACTATAACCTCAGCTCTATTTATCGTTTTTCTATTTGGAATCGTATTAGGTCTAATTCCTATGACTTTGGCTGGATTATTTGTGACCGCATATTTACAATACAGACGGGGGGATCAGTTGGACCTTTGA ATGCCTACTATCACTAGTTATTTCGGTTTTCTACTAGCAGTTTTAACTATAACCTCAGCTCTATTTATCGTTTTTCTATTTGGAATCGTATTAGGTCTAATTCCTATGACTTTGGCTGGATTATTTGTGACCGCATATTTACAATACAGACGGGGGGATCAGTTGGACCTTTGA MPTITSYFGFLLAVLTITSALFIVFLFGIVLGLIPMTLAGLFVTAYLQYRRGDQLDL Homology
BLAST of PI0001139 vs. ExPASy Swiss-Prot
Match: Q3V516 (Cytochrome b6-f complex subunit 5 OS=Acorus calamus OX=4465 GN=petG PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.0e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of PI0001139 vs. ExPASy Swiss-Prot
Match: Q5QA79 (Cytochrome b6-f complex subunit 5 OS=Acorus gramineus OX=55184 GN=petG PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.0e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of PI0001139 vs. ExPASy Swiss-Prot
Match: A1EA27 (Cytochrome b6-f complex subunit 5 OS=Agrostis stolonifera OX=63632 GN=petG PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.0e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of PI0001139 vs. ExPASy Swiss-Prot
Match: Q7FNS7 (Cytochrome b6-f complex subunit 5 OS=Atropa belladonna OX=33113 GN=petG PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.0e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of PI0001139 vs. ExPASy Swiss-Prot
Match: P69453 (Cytochrome b6-f complex subunit 5 OS=Beta trigyna OX=19769 GN=petG PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.0e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of PI0001139 vs. ExPASy TrEMBL
Match: A0A0A0KT11 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G576740 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 9.0e-18 Identity = 55/57 (96.49%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of PI0001139 vs. ExPASy TrEMBL
Match: A0A3S3NMV2 (Cytochrome b6-F complex subunit 5 OS=Cinnamomum micranthum f. kanehirae OX=337451 GN=CKAN_02722000 PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 1.3e-13 Identity = 51/63 (80.95%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of PI0001139 vs. ExPASy TrEMBL
Match: A0A6A5LB28 (Cytochrome b6-f complex subunit 6 OS=Lupinus albus OX=3870 GN=Lal_00028291 PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 5.1e-13 Identity = 55/93 (59.14%), Postives = 56/93 (60.22%), Query Frame = 0
BLAST of PI0001139 vs. ExPASy TrEMBL
Match: A0A5B6TKA9 (Cytochrome b6-f complex subunit 6 OS=Gossypium australe OX=47621 GN=petG PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 8.7e-13 Identity = 53/80 (66.25%), Postives = 54/80 (67.50%), Query Frame = 0
BLAST of PI0001139 vs. ExPASy TrEMBL
Match: A0A6A5MQ83 (Cytochrome b6-f complex subunit 6 OS=Lupinus albus OX=3870 GN=Lal_00033879 PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 3.3e-12 Identity = 51/74 (68.92%), Postives = 52/74 (70.27%), Query Frame = 0
BLAST of PI0001139 vs. NCBI nr
Match: RWR97765.1 (cytochrome b6-F complex subunit 5 [Cinnamomum micranthum f. kanehirae] >RWR98313.1 cytochrome b6-F complex subunit 5 [Cinnamomum micranthum f. kanehirae] >RWR98318.1 cytochrome b6-F complex subunit 5 [Cinnamomum micranthum f. kanehirae]) HSP 1 Score: 84.7 bits (208), Expect = 2.8e-13 Identity = 51/63 (80.95%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of PI0001139 vs. NCBI nr
Match: KAF1855872.1 (hypothetical protein Lal_00028291 [Lupinus albus]) HSP 1 Score: 82.8 bits (203), Expect = 1.0e-12 Identity = 55/93 (59.14%), Postives = 56/93 (60.22%), Query Frame = 0
BLAST of PI0001139 vs. NCBI nr
Match: KAA3441743.1 (cytochrome b6-F complex subunit 5 [Gossypium australe]) HSP 1 Score: 82.0 bits (201), Expect = 1.8e-12 Identity = 53/80 (66.25%), Postives = 54/80 (67.50%), Query Frame = 0
BLAST of PI0001139 vs. NCBI nr
Match: KAF1876954.1 (hypothetical protein Lal_00033879 [Lupinus albus]) HSP 1 Score: 80.1 bits (196), Expect = 6.8e-12 Identity = 51/74 (68.92%), Postives = 52/74 (70.27%), Query Frame = 0
BLAST of PI0001139 vs. NCBI nr
Match: MQL82473.1 (hypothetical protein [Colocasia esculenta]) HSP 1 Score: 80.1 bits (196), Expect = 6.8e-12 Identity = 48/61 (78.69%), Postives = 50/61 (81.97%), Query Frame = 0
BLAST of PI0001139 vs. TAIR 10
Match: ATCG00600.1 (PETG ) HSP 1 Score: 63.5 bits (153), Expect = 6.1e-11 Identity = 32/33 (96.97%), Postives = 33/33 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|