MS017395 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GTGAGGAATCCTCTTTTCGACTCTAACTCTTCCACTCCAGTCGTTGCTTTTCTTTCTGTTACTTCGAAAGTAGTTGCTTCAGCTTCAGCCACTCGAATTTTCGATATTCCTTCTTCTTTCTCATCAAACGAATGGCATCTTCTGATGGAAATCCTAGCTATTCTTAGCATGATATTGAGGAATCTCATTGCTATTACTCAAACAAGCATGAAACGTATGCTTGCGTCTTCGTCCATAGGTCAAATGGGAATTCTTCGA GTGAGGAATCCTCTTTTCGACTCTAACTCTTCCACTCCAGTCGTTGCTTTTCTTTCTGTTACTTCGAAAGTAGTTGCTTCAGCTTCAGCCACTCGAATTTTCGATATTCCTTCTTCTTTCTCATCAAACGAATGGCATCTTCTGATGGAAATCCTAGCTATTCTTAGCATGATATTGAGGAATCTCATTGCTATTACTCAAACAAGCATGAAACGTATGCTTGCGTCTTCGTCCATAGGTCAAATGGGAATTCTTCGA GTGAGGAATCCTCTTTTCGACTCTAACTCTTCCACTCCAGTCGTTGCTTTTCTTTCTGTTACTTCGAAAGTAGTTGCTTCAGCTTCAGCCACTCGAATTTTCGATATTCCTTCTTCTTTCTCATCAAACGAATGGCATCTTCTGATGGAAATCCTAGCTATTCTTAGCATGATATTGAGGAATCTCATTGCTATTACTCAAACAAGCATGAAACGTATGCTTGCGTCTTCGTCCATAGGTCAAATGGGAATTCTTCGA VRNPLFDSNSSTPVVAFLSVTSKVVASASATRIFDIPSSFSSNEWHLLMEILAILSMILRNLIAITQTSMKRMLASSSIGQMGILR Homology
BLAST of MS017395 vs. NCBI nr
Match: OTF84446.1 (putative NAD(P)H-quinone oxidoreductase subunit 2 A protein [Helianthus annuus] >OTF84578.1 putative NAD(P)H-quinone oxidoreductase subunit 2 A protein [Helianthus annuus]) HSP 1 Score: 134.4 bits (337), Expect = 4.6e-28 Identity = 75/83 (90.36%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of MS017395 vs. NCBI nr
Match: PLY80826.1 (hypothetical protein LSAT_3X112740 [Lactuca sativa]) HSP 1 Score: 134.4 bits (337), Expect = 4.6e-28 Identity = 75/83 (90.36%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of MS017395 vs. NCBI nr
Match: OTF84492.1 (putative NADH:quinone oxidoreductase/Mrp antiporter, membrane subunit [Helianthus annuus]) HSP 1 Score: 134.4 bits (337), Expect = 4.6e-28 Identity = 75/83 (90.36%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of MS017395 vs. NCBI nr
Match: YP_009503683.1 (NADH-plastoquinone oxidoreductase subunit 2 [Pluchea indica] >YP_009503698.1 NADH-plastoquinone oxidoreductase subunit 2 [Pluchea indica] >AWX66095.1 NADH-plastoquinone oxidoreductase subunit 2 [Pluchea indica] >AWX66096.1 NADH-plastoquinone oxidoreductase subunit 2 [Pluchea indica] >QTT78605.1 NADH-plastoquinone oxidoreductase subunit 2 [Pluchea pteropoda]) HSP 1 Score: 134.4 bits (337), Expect = 4.6e-28 Identity = 75/83 (90.36%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of MS017395 vs. NCBI nr
Match: YP_009912295.1 (NdhB [Fulcaldea stuessyi] >YP_009912312.1 NdhB [Fulcaldea stuessyi] >QEZ90602.1 NdhB [Archidasyphyllum excelsum] >QKY75398.1 NdhB [Barnadesia lehmannii] >QEZ90619.1 NdhB [Archidasyphyllum excelsum] >QKY75415.1 NdhB [Barnadesia lehmannii] >QLD96814.1 NdhB [Fulcaldea stuessyi]) HSP 1 Score: 134.4 bits (337), Expect = 4.6e-28 Identity = 75/83 (90.36%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of MS017395 vs. ExPASy Swiss-Prot
Match: P0CC20 (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Acorus americanus OX=263995 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.9e-25 Identity = 66/74 (89.19%), Postives = 68/74 (91.89%), Query Frame = 0
BLAST of MS017395 vs. ExPASy Swiss-Prot
Match: P0CC21 (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Acorus calamus OX=4465 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.9e-25 Identity = 66/74 (89.19%), Postives = 68/74 (91.89%), Query Frame = 0
BLAST of MS017395 vs. ExPASy Swiss-Prot
Match: P0CC34 (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Atropa belladonna OX=33113 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.9e-25 Identity = 66/74 (89.19%), Postives = 68/74 (91.89%), Query Frame = 0
BLAST of MS017395 vs. ExPASy Swiss-Prot
Match: P0CC38 (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Calycanthus floridus var. glaucus OX=212734 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.9e-25 Identity = 66/74 (89.19%), Postives = 68/74 (91.89%), Query Frame = 0
BLAST of MS017395 vs. ExPASy Swiss-Prot
Match: P0CC40 (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Carica papaya OX=3649 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.9e-25 Identity = 66/74 (89.19%), Postives = 68/74 (91.89%), Query Frame = 0
BLAST of MS017395 vs. ExPASy TrEMBL
Match: A0A344AV99 (NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic OS=Pluchea indica OX=175518 GN=ndhB PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 2.2e-28 Identity = 75/83 (90.36%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of MS017395 vs. ExPASy TrEMBL
Match: A0A1Y3BX13 (NADH-quinone oxidoreductase subunit N OS=Helianthus annuus OX=4232 GN=NU2C1 PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 2.2e-28 Identity = 75/83 (90.36%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of MS017395 vs. ExPASy TrEMBL
Match: A0A5J6RKU3 (NADH-quinone oxidoreductase subunit N OS=Archidasyphyllum excelsum OX=171774 GN=ndhB PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 2.2e-28 Identity = 75/83 (90.36%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of MS017395 vs. ExPASy TrEMBL
Match: A0A7D5FFD4 (NADH-quinone oxidoreductase subunit N OS=Fulcaldea stuessyi OX=1080004 GN=ndhB PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 2.2e-28 Identity = 75/83 (90.36%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of MS017395 vs. ExPASy TrEMBL
Match: A0A7D5FEF1 (NADH-quinone oxidoreductase subunit N OS=Doniophyton anomalum OX=41570 GN=ndhB PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 2.2e-28 Identity = 75/83 (90.36%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of MS017395 vs. TAIR 10
Match: ATCG00890.1 (NADH-Ubiquinone/plastoquinone (complex I) protein ) HSP 1 Score: 114.0 bits (284), Expect = 6.0e-26 Identity = 65/74 (87.84%), Postives = 67/74 (90.54%), Query Frame = 0
BLAST of MS017395 vs. TAIR 10
Match: ATCG01250.1 (NADH-Ubiquinone/plastoquinone (complex I) protein ) HSP 1 Score: 114.0 bits (284), Expect = 6.0e-26 Identity = 65/74 (87.84%), Postives = 67/74 (90.54%), Query Frame = 0
BLAST of MS017395 vs. TAIR 10
Match: AT2G07689.1 (NADH-Ubiquinone/plastoquinone (complex I) protein ) HSP 1 Score: 43.9 bits (102), Expect = 7.6e-05 Identity = 33/77 (42.86%), Postives = 45/77 (58.44%), Query Frame = 0
BLAST of MS017395 vs. TAIR 10
Match: ATMG00285.1 (NADH dehydrogenase 2A ) HSP 1 Score: 43.9 bits (102), Expect = 7.6e-05 Identity = 33/77 (42.86%), Postives = 45/77 (58.44%), Query Frame = 0
BLAST of MS017395 vs. TAIR 10
Match: ATMG01320.1 (NADH dehydrogenase 2B ) HSP 1 Score: 43.9 bits (102), Expect = 7.6e-05 Identity = 33/77 (42.86%), Postives = 45/77 (58.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|