MS011516 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATTGAAGGGGAAAGAGACATCACTTTAGGCTTTGTTGATTTACTTCGTGATGAGTATGTTGAAAAAGATCGAAGCCGCGGTATTTATTTCACTCAAGATTATGGGTTGGTATTCACGTTTGGTATATGCCTGCTCTGACCGAGATTTTTGGAGATGATTTTGTACTACAATTCGGCGGAGGAACTTTAGAGCACCCTTGGGGTAATGCACCTAGTGCCGTAGCTAATCGAGTAGCTCTAGAAGCATGTGTACAAGCTCGTAATGAA ATTGAAGGGGAAAGAGACATCACTTTAGGCTTTGTTGATTTACTTCGTGATGAGTATGTTGAAAAAGATCGAAGCCGCGGTATTTATTTCACTCAATGGGTTGGTATTCACGTTTGGTATATGCCTGCTCTGACCGAGATTTTTGGAGATGATTTTGTACTACAATTCGGCGGAGGAACTTTAGAGCACCCTTGGGGTAATGCACCTAGTGCCGTAGCTAATCGAGTAGCTCTAGAAGCATGTGTACAAGCTCGTAATGAA ATTGAAGGGGAAAGAGACATCACTTTAGGCTTTGTTGATTTACTTCGTGATGAGTATGTTGAAAAAGATCGAAGCCGCGGTATTTATTTCACTCAATGGGTTGGTATTCACGTTTGGTATATGCCTGCTCTGACCGAGATTTTTGGAGATGATTTTGTACTACAATTCGGCGGAGGAACTTTAGAGCACCCTTGGGGTAATGCACCTAGTGCCGTAGCTAATCGAGTAGCTCTAGAAGCATGTGTACAAGCTCGTAATGAA IEGERDITLGFVDLLRDEYVEKDRSRGIYFTQWVGIHVWYMPALTEIFGDDFVLQFGGGTLEHPWGNAPSAVANRVALEACVQARNE Homology
BLAST of MS011516 vs. NCBI nr
Match: AAY90070.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Dendrosicyos socotranus]) HSP 1 Score: 164.9 bits (416), Expect = 3.2e-37 Identity = 80/99 (80.81%), Postives = 85/99 (85.86%), Query Frame = 0
BLAST of MS011516 vs. NCBI nr
Match: ALX36892.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Momordica charantia]) HSP 1 Score: 164.9 bits (416), Expect = 3.2e-37 Identity = 82/99 (82.83%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. NCBI nr
Match: ABG24929.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Momordica charantia]) HSP 1 Score: 164.9 bits (416), Expect = 3.2e-37 Identity = 82/99 (82.83%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. NCBI nr
Match: YP_009456069.1 (ribulose-1 [Momordica charantia] >AUJ21836.1 ribulose-1 [Momordica charantia]) HSP 1 Score: 164.9 bits (416), Expect = 3.2e-37 Identity = 82/99 (82.83%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. NCBI nr
Match: AMD82865.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Rumex flexuosus]) HSP 1 Score: 163.7 bits (413), Expect = 7.1e-37 Identity = 81/99 (81.82%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. ExPASy Swiss-Prot
Match: P28434 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Nepenthes alata OX=4376 GN=rbcL PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 9.4e-40 Identity = 81/99 (81.82%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. ExPASy Swiss-Prot
Match: Q05986 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Callitriche heterophylla OX=13381 GN=rbcL PE=3 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.2e-39 Identity = 80/99 (80.81%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. ExPASy Swiss-Prot
Match: P28409 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Drosera peltata OX=4369 GN=rbcL PE=3 SV=2) HSP 1 Score: 163.3 bits (412), Expect = 1.2e-39 Identity = 80/99 (80.81%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. ExPASy Swiss-Prot
Match: Q05994 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Villarsia calthifolia OX=13756 GN=rbcL PE=3 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.2e-39 Identity = 80/99 (80.81%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. ExPASy Swiss-Prot
Match: P43225 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Arthropteris beckleri OX=29631 GN=rbcL PE=3 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 2.1e-39 Identity = 78/99 (78.79%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. ExPASy TrEMBL
Match: A0A0U3MZI0 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Momordica charantia OX=3673 GN=rbcL PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 1.6e-37 Identity = 82/99 (82.83%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. ExPASy TrEMBL
Match: A5X4E1 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Momordica charantia OX=3673 GN=rbcL PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 1.6e-37 Identity = 82/99 (82.83%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. ExPASy TrEMBL
Match: A0A2I6C015 (Ribulose bisphosphate carboxylase large chain OS=Momordica charantia OX=3673 GN=rbcL PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 1.6e-37 Identity = 82/99 (82.83%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. ExPASy TrEMBL
Match: Q2HJK4 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Dendrosicyos socotranus OX=229694 GN=rbcL PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 1.6e-37 Identity = 80/99 (80.81%), Postives = 85/99 (85.86%), Query Frame = 0
BLAST of MS011516 vs. ExPASy TrEMBL
Match: A0A291PUL7 (Ribulose bisphosphate carboxylase large chain OS=Cryptocarya chinensis OX=128609 GN=rbcL PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 3.5e-37 Identity = 81/99 (81.82%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of MS011516 vs. TAIR 10
Match: ATCG00490.1 (ribulose-bisphosphate carboxylases ) HSP 1 Score: 157.1 bits (396), Expect = 6.2e-39 Identity = 77/99 (77.78%), Postives = 83/99 (83.84%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|