MS005185 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTCAGAATAAAAAAGACATATGGTAGCATCGTAATCATAGAATATGACCCTAATCGAAATGCATACATTTGTCTCATATACTATAGGGATGGTGAGAAAAGACATATTTTACGTTCTAGAGAGACTATAATT TTCAGAATAAAAAAGACATATGGTAGCATCGTAATCATAGAATATGACCCTAATCGAAATGCATACATTTGTCTCATATACTATAGGGATGGTGAGAAAAGACATATTTTACGTTCTAGAGAGACTATAATT TTCAGAATAAAAAAGACATATGGTAGCATCGTAATCATAGAATATGACCCTAATCGAAATGCATACATTTGTCTCATATACTATAGGGATGGTGAGAAAAGACATATTTTACGTTCTAGAGAGACTATAATT FRIKKTYGSIVIIEYDPNRNAYICLIYYRDGEKRHILRSRETII Homology
BLAST of MS005185 vs. NCBI nr
Match: QKZ95141.1 (ribosomal protein L2 [Parthenium hysterophorus]) HSP 1 Score: 69.7 bits (169), Expect = 7.1e-09 Identity = 32/41 (78.05%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of MS005185 vs. NCBI nr
Match: QKZ95118.1 (ribosomal protein L2 [Parthenium hysterophorus]) HSP 1 Score: 69.7 bits (169), Expect = 7.1e-09 Identity = 32/41 (78.05%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of MS005185 vs. NCBI nr
Match: YP_009309817.1 (ribosomal protein L2 [Orobanche pancicii] >ALJ02272.1 ribosomal protein L2 [Orobanche pancicii]) HSP 1 Score: 69.7 bits (169), Expect = 7.1e-09 Identity = 32/41 (78.05%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MS005185 vs. NCBI nr
Match: YP_009674176.1 (ribosomal protein L2 [Diphelypaea coccinea] >YP_009674178.1 ribosomal protein L2 [Diphelypaea coccinea] >QDJ93987.1 ribosomal protein L2 [Diphelypaea coccinea] >QDJ93989.1 ribosomal protein L2 [Diphelypaea coccinea]) HSP 1 Score: 69.3 bits (168), Expect = 9.3e-09 Identity = 31/41 (75.61%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MS005185 vs. NCBI nr
Match: YP_009493746.1 (ribosomal protein L2 [Weigela florida] >AWN57661.1 ribosomal protein L2 [Weigela florida]) HSP 1 Score: 68.2 bits (165), Expect = 2.1e-08 Identity = 31/41 (75.61%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of MS005185 vs. ExPASy Swiss-Prot
Match: Q1KXP4 (50S ribosomal protein L2, chloroplastic OS=Helianthus annuus OX=4232 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 3.5e-11 Identity = 31/41 (75.61%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of MS005185 vs. ExPASy Swiss-Prot
Match: Q332R5 (50S ribosomal protein L2, chloroplastic OS=Lactuca sativa OX=4236 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 3.5e-11 Identity = 31/41 (75.61%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of MS005185 vs. ExPASy Swiss-Prot
Match: Q9B1H9 (50S ribosomal protein L2, chloroplastic OS=Lotus japonicus OX=34305 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 1.3e-10 Identity = 30/41 (73.17%), Postives = 32/41 (78.05%), Query Frame = 0
BLAST of MS005185 vs. ExPASy Swiss-Prot
Match: A6MM78 (50S ribosomal protein L2, chloroplastic OS=Buxus microphylla OX=153571 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 1.8e-10 Identity = 30/41 (73.17%), Postives = 32/41 (78.05%), Query Frame = 0
BLAST of MS005185 vs. ExPASy Swiss-Prot
Match: P06509 (50S ribosomal protein L2, chloroplastic OS=Spinacia oleracea OX=3562 GN=rpl2-A PE=1 SV=4) HSP 1 Score: 65.5 bits (158), Expect = 1.8e-10 Identity = 30/41 (73.17%), Postives = 32/41 (78.05%), Query Frame = 0
BLAST of MS005185 vs. ExPASy TrEMBL
Match: A0A7D5HSX0 (50S ribosomal protein L2, chloroplastic OS=Parthenium hysterophorus OX=183063 GN=rpl2 PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 3.4e-09 Identity = 32/41 (78.05%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of MS005185 vs. ExPASy TrEMBL
Match: A0A7D5HHA6 (50S ribosomal protein L2, chloroplastic OS=Parthenium hysterophorus OX=183063 GN=rpl2 PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 3.4e-09 Identity = 32/41 (78.05%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of MS005185 vs. ExPASy TrEMBL
Match: A0A1C8E275 (50S ribosomal protein L2, chloroplastic OS=Orobanche pancicii OX=1115516 GN=rpl2 PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 3.4e-09 Identity = 32/41 (78.05%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MS005185 vs. ExPASy TrEMBL
Match: A0A514TND5 (50S ribosomal protein L2, chloroplastic OS=Phelypaea coccinea OX=223087 GN=rpl2 PE=3 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 4.5e-09 Identity = 31/41 (75.61%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MS005185 vs. ExPASy TrEMBL
Match: A0A2U8XH78 (50S ribosomal protein L2, chloroplastic OS=Weigela florida OX=79612 GN=rpl2 PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 1.0e-08 Identity = 31/41 (75.61%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of MS005185 vs. TAIR 10
Match: ATCG00830.1 (ribosomal protein L2 ) HSP 1 Score: 65.1 bits (157), Expect = 1.6e-11 Identity = 30/41 (73.17%), Postives = 32/41 (78.05%), Query Frame = 0
BLAST of MS005185 vs. TAIR 10
Match: ATCG01310.1 (ribosomal protein L2 ) HSP 1 Score: 65.1 bits (157), Expect = 1.6e-11 Identity = 30/41 (73.17%), Postives = 32/41 (78.05%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|