MC08g2494 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GCTTATCGGGATAGAGGTAGGCAAAAAAGAAATTTTCGACATTTGTGGATCGCTCGAATAAATGCAGTAATTCGATATAATAAGGTATACTACAGTTATAGTAGATTCATACACAATATGTACAAGGGTCAGTTGCTTCTTAATCGTAAAATACTTGCCCAAATCGCN GCTTATCGGGATAGAGGTAGGCAAAAAAGAAATTTTCGACATTTGTGGATCGCTCGAATAAATGCAGTAATTCGATATAATAAGGTATACTACAGTTATAGTAGATTCATACACAATATGTACAAGGGTCAGTTGCTTCTTAATCGTAAAATACTTGCCCAAATCGCN GCTTATCGGGATAGAGGTAGGCAAAAAAGAAATTTTCGACATTTGTGGATCGCTCGAATAAATGCAGTAATTCGATATAATAAGGTATACTACAGTTATAGTAGATTCATACACAATATGTACAAGGGTCAGTTGCTTCTTAATCGTAAAATACTTGCCCAAATCGCN AYRDRGRQKRNFRHLWIARINAVIRYNKVYYSYSRFIHNMYKGQLLLNRKILAQIX Homology
BLAST of MC08g2494 vs. ExPASy Swiss-Prot
Match: Q4VZJ4 (50S ribosomal protein L20, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl20 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 9.1e-20 Identity = 49/55 (89.09%), Postives = 50/55 (90.91%), Query Frame = 0
BLAST of MC08g2494 vs. ExPASy Swiss-Prot
Match: Q09G23 (50S ribosomal protein L20, chloroplastic OS=Platanus occidentalis OX=4403 GN=rpl20 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 3.8e-18 Identity = 46/55 (83.64%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MC08g2494 vs. ExPASy Swiss-Prot
Match: Q09WZ4 (50S ribosomal protein L20, chloroplastic OS=Morus indica OX=248361 GN=rpl20 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 1.9e-17 Identity = 44/55 (80.00%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MC08g2494 vs. ExPASy Swiss-Prot
Match: A6MM59 (50S ribosomal protein L20, chloroplastic OS=Buxus microphylla OX=153571 GN=rpl20 PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 5.5e-17 Identity = 43/55 (78.18%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MC08g2494 vs. ExPASy Swiss-Prot
Match: A9L9B9 (50S ribosomal protein L20, chloroplastic OS=Lemna minor OX=4472 GN=rpl20 PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 5.5e-17 Identity = 44/55 (80.00%), Postives = 47/55 (85.45%), Query Frame = 0
BLAST of MC08g2494 vs. NCBI nr
Match: YP_009456084.1 (ribosomal protein L20 [Momordica charantia] >AUJ21851.1 ribosomal protein L20 [Momordica charantia]) HSP 1 Score: 113 bits (283), Expect = 7.77e-31 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of MC08g2494 vs. NCBI nr
Match: YP_009752943.1 (ribosomal protein L20 [Momordica sessilifolia] >QIT06015.1 ribosomal protein L20 [Momordica sessilifolia]) HSP 1 Score: 112 bits (280), Expect = 2.23e-30 Identity = 54/55 (98.18%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of MC08g2494 vs. NCBI nr
Match: YP_009674414.1 (ribosomal protein L20 [Siraitia grosvenorii] >YP_009738224.1 ribosomal protein L20 [Siraitia siamensis] >QDK59412.1 ribosomal protein L20 [Siraitia grosvenorii] >QDK99969.1 ribosomal protein L20 [Siraitia grosvenorii] >QIB71528.1 ribosomal protein L20 [Siraitia grosvenorii] >QIB71616.1 ribosomal protein L20 [Siraitia siamensis] >QJA16166.1 ribosomal protein L20 [Siraitia grosvenorii]) HSP 1 Score: 109 bits (272), Expect = 3.68e-29 Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of MC08g2494 vs. NCBI nr
Match: YP_009752689.1 (ribosomal protein L20 [Ampelosycios humblotii] >QIT05170.1 ribosomal protein L20 [Ampelosycios humblotii]) HSP 1 Score: 108 bits (270), Expect = 7.41e-29 Identity = 52/55 (94.55%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of MC08g2494 vs. NCBI nr
Match: QJS52361.1 (ribosomal protein L20 [Indofevillea khasiana]) HSP 1 Score: 108 bits (269), Expect = 1.05e-28 Identity = 52/55 (94.55%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of MC08g2494 vs. ExPASy TrEMBL
Match: A0A2I6C027 (50S ribosomal protein L20, chloroplastic OS=Momordica charantia OX=3673 GN=rpl20 PE=3 SV=1) HSP 1 Score: 113 bits (283), Expect = 3.76e-31 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of MC08g2494 vs. ExPASy TrEMBL
Match: A0A6H0EW12 (50S ribosomal protein L20, chloroplastic OS=Momordica sessilifolia OX=703387 GN=rpl20 PE=3 SV=1) HSP 1 Score: 112 bits (280), Expect = 1.08e-30 Identity = 54/55 (98.18%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of MC08g2494 vs. ExPASy TrEMBL
Match: A0A514YKV6 (50S ribosomal protein L20, chloroplastic OS=Siraitia grosvenorii OX=190515 GN=rpl20 PE=3 SV=1) HSP 1 Score: 109 bits (272), Expect = 1.78e-29 Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of MC08g2494 vs. ExPASy TrEMBL
Match: A0A6C0U950 (50S ribosomal protein L20, chloroplastic OS=Siraitia siamensis OX=2695833 GN=rpl20 PE=3 SV=1) HSP 1 Score: 109 bits (272), Expect = 1.78e-29 Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of MC08g2494 vs. ExPASy TrEMBL
Match: A0A6H0ET10 (50S ribosomal protein L20, chloroplastic OS=Ampelosycios humblotii OX=386639 GN=rpl20 PE=3 SV=1) HSP 1 Score: 108 bits (270), Expect = 3.59e-29 Identity = 52/55 (94.55%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of MC08g2494 vs. TAIR 10
Match: ATCG00660.1 (ribosomal protein L20 ) HSP 1 Score: 82.0 bits (201), Expect = 1.6e-16 Identity = 40/55 (72.73%), Postives = 47/55 (85.45%), Query Frame = 0
BLAST of MC08g2494 vs. TAIR 10
Match: AT1G16740.1 (Ribosomal protein L20 ) HSP 1 Score: 50.1 bits (118), Expect = 6.9e-07 Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|