MC06g1529 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TATGGCGTATTTCTCCTATTCAAACAGGGGTTTGAAACCAAAATTCTCCTCAGGAGGATAAATGGGGCGATTCAGGTGAGATCCAACGTAGATCCAACTTTCTATTTACTCGTGGGATCCAGGCCGCCCAGGGGGACCACCTCGGCTCCTCTTTTCTCGAGAATCCATACATCCCTTAT TATGGCGTATTTCTCCTATTCAAACAGGGGTTTGAAACCAAAATTCTCCTCAGGAGGATAAATGGGGCGATTCAGGTGAGATCCAACGTAGATCCAACTTTCTATTTACTCGTGGGATCCAGGGCCCAGGGGGACCACCTCGGCTCCTCTTTTCTCGAGAATCCATACATCCCTTAT TATGGCGTATTTCTCCTATTCAAACAGGGGTTTGAAACCAAAATTCTCCTCAGGAGGATAAATGGGGCGATTCAGGTGAGATCCAACGTAGATCCAACTTTCTATTTACTCGTGGGATCCAGGGCCCAGGGGGACCACCTCGGCTCCTCTTTTCTCGAGAATCCATACATCCCTTAT YGVFLLFKQGFETKILLRRINGAIQVRSNVDPTFYLLVGSRAQGDHLGSSFLENPYIPY Homology
BLAST of MC06g1529 vs. ExPASy Swiss-Prot
Match: Q49KT9 (Uncharacterized protein ycf68 OS=Eucalyptus globulus subsp. globulus OX=71271 GN=ycf68-1 PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 8.4e-16 Identity = 42/53 (79.25%), Postives = 45/53 (84.91%), Query Frame = 0
BLAST of MC06g1529 vs. ExPASy Swiss-Prot
Match: Q85WV9 (Uncharacterized protein ycf68 OS=Pinus koraiensis OX=88728 GN=ycf68 PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.5e-12 Identity = 36/58 (62.07%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of MC06g1529 vs. ExPASy Swiss-Prot
Match: P52807 (Uncharacterized protein ycf68 OS=Pinus thunbergii OX=3350 GN=ycf68 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 3.3e-12 Identity = 36/58 (62.07%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of MC06g1529 vs. ExPASy Swiss-Prot
Match: P03938 (Uncharacterized protein ycf68 OS=Zea mays OX=4577 GN=ycf68 PE=3 SV=2) HSP 1 Score: 47.4 bits (111), Expect = 6.6e-05 Identity = 23/31 (74.19%), Postives = 26/31 (83.87%), Query Frame = 0
BLAST of MC06g1529 vs. ExPASy Swiss-Prot
Match: Q6L3C9 (Uncharacterized protein ycf68 OS=Saccharum hybrid OX=15819 GN=ycf68-1 PE=3 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 6.6e-05 Identity = 23/31 (74.19%), Postives = 26/31 (83.87%), Query Frame = 0
BLAST of MC06g1529 vs. NCBI nr
Match: MVM42569.1 (DUF2647 domain-containing protein [Staphylococcus aureus]) HSP 1 Score: 96.3 bits (238), Expect = 3.76e-24 Identity = 48/60 (80.00%), Postives = 53/60 (88.33%), Query Frame = 0
BLAST of MC06g1529 vs. NCBI nr
Match: KAG4109264.1 (hypothetical protein ERO13_1Z049482v2, partial [Gossypium hirsutum]) HSP 1 Score: 94.7 bits (234), Expect = 8.78e-24 Identity = 47/60 (78.33%), Postives = 53/60 (88.33%), Query Frame = 0
BLAST of MC06g1529 vs. NCBI nr
Match: TYJ27401.1 (hypothetical protein E1A91_A07G185000v1, partial [Gossypium mustelinum]) HSP 1 Score: 94.4 bits (233), Expect = 1.25e-23 Identity = 47/60 (78.33%), Postives = 53/60 (88.33%), Query Frame = 0
BLAST of MC06g1529 vs. NCBI nr
Match: KAB2082065.1 (hypothetical protein ES319_A05G173300v1, partial [Gossypium barbadense]) HSP 1 Score: 90.5 bits (223), Expect = 4.07e-22 Identity = 46/59 (77.97%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of MC06g1529 vs. NCBI nr
Match: KAA1416305.1 (DUF2647 domain-containing protein [Nocardioides antri] >MVL64162.1 DUF2647 domain-containing protein [Staphylococcus aureus]) HSP 1 Score: 89.7 bits (221), Expect = 7.36e-22 Identity = 44/55 (80.00%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MC06g1529 vs. ExPASy TrEMBL
Match: A0A5D2YQI0 (Uncharacterized protein ycf68 (Fragment) OS=Gossypium mustelinum OX=34275 GN=E1A91_A07G185000v1 PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 6.04e-24 Identity = 47/60 (78.33%), Postives = 53/60 (88.33%), Query Frame = 0
BLAST of MC06g1529 vs. ExPASy TrEMBL
Match: A0A5J5VQY1 (Uncharacterized protein ycf68 (Fragment) OS=Gossypium barbadense OX=3634 GN=ES319_A05G173300v1 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.97e-22 Identity = 46/59 (77.97%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of MC06g1529 vs. ExPASy TrEMBL
Match: A0A5B1L6Z4 (DUF2647 domain-containing protein OS=Nocardioides sp. BN140041 OX=2607659 GN=F0U47_20625 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 3.57e-22 Identity = 44/55 (80.00%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MC06g1529 vs. ExPASy TrEMBL
Match: A0A3N9TAC2 (DUF2647 domain-containing protein OS=Vibrio viridaestus OX=2487322 GN=EES38_21915 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 3.57e-22 Identity = 44/55 (80.00%), Postives = 49/55 (89.09%), Query Frame = 0
BLAST of MC06g1529 vs. ExPASy TrEMBL
Match: A0A7S8WWX1 (Uncharacterized protein OS=Gynandropsis gynandra OX=190802 GN=ycf68 PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 7.20e-22 Identity = 44/55 (80.00%), Postives = 49/55 (89.09%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|