MC05g0553 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GCACGACCCGGCGATCAAATTCTTGGTGGGAATCATCAACTTTATAATGTTTTAATAACGGCTCACGCTTTTTTAATGATCTTTTTTATGGTTATGCCGGCGGTC GCACGACCCGGCGATCAAATTCTTGGTGGGAATCATCAACTTTATAATGTTTTAATAACGGCTCACGCTTTTTTAATGATCTTTTTTATGGTTATGCCGGCGGTC GCACGACCCGGCGATCAAATTCTTGGTGGGAATCATCAACTTTATAATGTTTTAATAACGGCTCACGCTTTTTTAATGATCTTTTTTATGGTTATGCCGGCGGTC ARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAV Homology
BLAST of MC05g0553 vs. ExPASy Swiss-Prot
Match: P68540 (Cytochrome c oxidase subunit 1 OS=Aegilops columnaris OX=4493 GN=COX1 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 4.3e-12 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. ExPASy Swiss-Prot
Match: P60620 (Cytochrome c oxidase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=COX1 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 4.3e-12 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. ExPASy Swiss-Prot
Match: P24794 (Cytochrome c oxidase subunit 1 OS=Beta vulgaris OX=161934 GN=COX1 PE=3 SV=2) HSP 1 Score: 70.5 bits (171), Expect = 4.3e-12 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. ExPASy Swiss-Prot
Match: P08742 (Cytochrome c oxidase subunit 1 OS=Zea mays OX=4577 GN=COX1 PE=3 SV=2) HSP 1 Score: 70.5 bits (171), Expect = 4.3e-12 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. ExPASy Swiss-Prot
Match: P08743 (Cytochrome c oxidase subunit 1 OS=Oenothera berteroana OX=3950 GN=COX1 PE=3 SV=2) HSP 1 Score: 70.5 bits (171), Expect = 4.3e-12 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. NCBI nr
Match: WP_189895428.1 (cbb3-type cytochrome c oxidase subunit I, partial [Streptomyces canarius]) HSP 1 Score: 71.2 bits (173), Expect = 5.74e-15 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. NCBI nr
Match: WP_190167551.1 (cbb3-type cytochrome c oxidase subunit I, partial [Streptomyces malachitofuscus]) HSP 1 Score: 70.1 bits (170), Expect = 1.64e-14 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. NCBI nr
Match: WP_190133636.1 (cbb3-type cytochrome c oxidase subunit I, partial [Streptomyces gardneri]) HSP 1 Score: 69.7 bits (169), Expect = 2.28e-14 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. NCBI nr
Match: AFY03536.1 (cytochrome c oxidase subunit 1, partial [Lagenaria siceraria]) HSP 1 Score: 71.2 bits (173), Expect = 3.30e-14 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. NCBI nr
Match: AUD10199.1 (cytochrome c oxidase subunit 1, partial [Nepenthes khasiana]) HSP 1 Score: 71.2 bits (173), Expect = 4.96e-14 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. ExPASy TrEMBL
Match: K7YUF6 (Cytochrome c oxidase subunit 1 (Fragment) OS=Lagenaria siceraria OX=3668 PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 1.60e-14 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. ExPASy TrEMBL
Match: A0A3S6Q7S9 (Cytochrome c oxidase subunit 1 (Fragment) OS=Nepenthes khasiana OX=122310 GN=COI PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 2.40e-14 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. ExPASy TrEMBL
Match: E1CBG1 (Cytochrome c oxidase subunit 1 (Fragment) OS=Cycas taitungensis OX=54799 GN=cox1 PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.49e-14 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. ExPASy TrEMBL
Match: A0A2K8ZEU4 (Cytochrome c oxidase subunit 1 (Fragment) OS=Utricularia bifida OX=1398144 GN=COI PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 2.55e-14 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. ExPASy TrEMBL
Match: A0A2K8ZCR1 (Cytochrome c oxidase subunit 1 (Fragment) OS=Drosera burmannii OX=4365 GN=COI PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 2.60e-14 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC05g0553 vs. TAIR 10
Match: ATMG01360.1 (cytochrome oxidase ) HSP 1 Score: 70.5 bits (171), Expect = 3.1e-13 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|