MC04g0818 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AAACACAATAAACAGAAAGTTACTTTACCCCTTTTTACTTTTCATGAGAAATTGGCCAAACTAAGGAAAAAGAAAAAAGAAATAGCATTAAAATATATTTTTATTGACCAATCAGAATTGCCTCCC AAACACAATAAACAGAAAGTTACTTTACCCCTTTTTACTTTTCATGAGAAATTGGCCAAACTAAGGAAAAAGAAAAAAGAAATAGCATTAAAATATATTTTTATTGACCAATCAGAATTGCCTCCC AAACACAATAAACAGAAAGTTACTTTACCCCTTTTTACTTTTCATGAGAAATTGGCCAAACTAAGGAAAAAGAAAAAAGAAATAGCATTAAAATATATTTTTATTGACCAATCAGAATTGCCTCCC KHNKQKVTLPLFTFHEKLAKLRKKKKEIALKYIFIDQSELPP Homology
BLAST of MC04g0818 vs. ExPASy Swiss-Prot
Match: Q4VZK3 (DNA-directed RNA polymerase subunit alpha OS=Cucumis sativus OX=3659 GN=rpoA PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 3.0e-15 Identity = 40/42 (95.24%), Postives = 42/42 (100.00%), Query Frame = 0
BLAST of MC04g0818 vs. ExPASy Swiss-Prot
Match: Q09G14 (DNA-directed RNA polymerase subunit alpha OS=Platanus occidentalis OX=4403 GN=rpoA PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 9.8e-11 Identity = 31/40 (77.50%), Postives = 36/40 (90.00%), Query Frame = 0
BLAST of MC04g0818 vs. ExPASy Swiss-Prot
Match: Q49KW6 (DNA-directed RNA polymerase subunit alpha OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rpoA PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 1.7e-10 Identity = 32/42 (76.19%), Postives = 37/42 (88.10%), Query Frame = 0
BLAST of MC04g0818 vs. ExPASy Swiss-Prot
Match: Q2L938 (DNA-directed RNA polymerase subunit alpha OS=Gossypium hirsutum OX=3635 GN=rpoA PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 1.7e-10 Identity = 31/42 (73.81%), Postives = 36/42 (85.71%), Query Frame = 0
BLAST of MC04g0818 vs. ExPASy Swiss-Prot
Match: Q09ME5 (DNA-directed RNA polymerase subunit alpha OS=Citrus sinensis OX=2711 GN=rpoA PE=3 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 4.9e-10 Identity = 31/42 (73.81%), Postives = 37/42 (88.10%), Query Frame = 0
BLAST of MC04g0818 vs. NCBI nr
Match: YP_009752867.1 (RNA polymerase subunit alpha [Baijiania yunnanensis] >QIT05939.1 RNA polymerase subunit alpha [Baijiania yunnanensis]) HSP 1 Score: 82.4 bits (202), Expect = 4.21e-17 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 0
BLAST of MC04g0818 vs. NCBI nr
Match: YP_009752107.1 (RNA polymerase subunit alpha [Dendrosicyos socotranus] >QIT05517.1 RNA polymerase subunit alpha [Dendrosicyos socotranus]) HSP 1 Score: 82.4 bits (202), Expect = 4.21e-17 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 0
BLAST of MC04g0818 vs. NCBI nr
Match: YP_009456093.1 (RNA polymerase alpha subunit [Momordica charantia] >AUJ21860.1 RNA polymerase alpha subunit [Momordica charantia]) HSP 1 Score: 82.4 bits (202), Expect = 4.21e-17 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 0
BLAST of MC04g0818 vs. NCBI nr
Match: ALO21933.1 (RpoA [Cucurbita cordata] >ALO22018.1 RpoA [Cucurbita digitata]) HSP 1 Score: 82.4 bits (202), Expect = 4.21e-17 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 0
BLAST of MC04g0818 vs. NCBI nr
Match: YP_009752022.1 (RNA polymerase subunit alpha [Cionosicys macranthus] >QIT05263.1 RNA polymerase subunit alpha [Cionosicys macranthus]) HSP 1 Score: 82.4 bits (202), Expect = 4.21e-17 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 0
BLAST of MC04g0818 vs. ExPASy TrEMBL
Match: A0A6H0ES49 (DNA-directed RNA polymerase subunit alpha OS=Indofevillea khasiana OX=383665 GN=rpoA PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.04e-17 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 0
BLAST of MC04g0818 vs. ExPASy TrEMBL
Match: A0A0S2IF96 (DNA-directed RNA polymerase subunit alpha OS=Cucurbita moschata OX=3662 GN=rpoA PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.04e-17 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 0
BLAST of MC04g0818 vs. ExPASy TrEMBL
Match: A0A514YKX0 (DNA-directed RNA polymerase subunit alpha OS=Siraitia grosvenorii OX=190515 GN=rpoA PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.04e-17 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 0
BLAST of MC04g0818 vs. ExPASy TrEMBL
Match: A0A6H0EP10 (DNA-directed RNA polymerase subunit alpha OS=Luffa aegyptiaca OX=3670 GN=rpoA PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.04e-17 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 0
BLAST of MC04g0818 vs. ExPASy TrEMBL
Match: A0A0S2IDS0 (DNA-directed RNA polymerase subunit alpha OS=Cucurbita argyrosperma OX=34294 GN=rpoA PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.04e-17 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 0
BLAST of MC04g0818 vs. TAIR 10
Match: ATCG00740.1 (RNA polymerase subunit alpha ) HSP 1 Score: 54.7 bits (130), Expect = 2.1e-08 Identity = 27/44 (61.36%), Postives = 34/44 (77.27%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|