IVF0018241 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAACTTAATGCATTTAGGCGTATGCCATTTGGTCTTTGTAATGCACCGGGCACATTCCAACGTTGCATGATGAGCATATTTTCCGACTTTATTGAAAAATTCATTGAAGTTTTCATGGATGATTTCACAGTTTATGGTGATAGTTTTTATGCATGTTTAGCCAGTCTAGAATTAATTCTAAATAGATGCATAGAAACTAACCTTGTCTTGAATTATGAAAAGTGTCATTTCATGGTGTCTCATGGTATAGTTTTATGA ATGGAACTTAATGCATTTAGGCGTATGCCATTTGGTCTTTGTAATGCACCGGGCACATTCCAACGTTGCATGATGAGCATATTTTCCGACTTTATTGAAAAATTCATTGAAGTTTTCATGGATGATTTCACAGTTTATGAATTAATTCTAAATAGATGCATAGAAACTAACCTTGTCTTGAATTATGAAAAGTGTCATTTCATGGTGTCTCATGGTATAGTTTTATGA ATGGAACTTAATGCATTTAGGCGTATGCCATTTGGTCTTTGTAATGCACCGGGCACATTCCAACGTTGCATGATGAGCATATTTTCCGACTTTATTGAAAAATTCATTGAAGTTTTCATGGATGATTTCACAGTTTATGAATTAATTCTAAATAGATGCATAGAAACTAACCTTGTCTTGAATTATGAAAAGTGTCATTTCATGGTGTCTCATGGTATAGTTTTATGA MELNAFRRMPFGLCNAPGTFQRCMMSIFSDFIEKFIEVFMDDFTVYELILNRCIETNLVLNYEKCHFMVSHGIVL Homology
BLAST of IVF0018241 vs. ExPASy Swiss-Prot
Match: P20825 (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.4e-07 Identity = 27/74 (36.49%), Postives = 40/74 (54.05%), Query Frame = 0
BLAST of IVF0018241 vs. ExPASy Swiss-Prot
Match: P04323 (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 5.3e-07 Identity = 28/74 (37.84%), Postives = 38/74 (51.35%), Query Frame = 0
BLAST of IVF0018241 vs. ExPASy Swiss-Prot
Match: Q8I7P9 (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 4.9e-05 Identity = 28/74 (37.84%), Postives = 38/74 (51.35%), Query Frame = 0
BLAST of IVF0018241 vs. ExPASy Swiss-Prot
Match: Q99315 (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3) HSP 1 Score: 47.0 bits (110), Expect = 1.1e-04 Identity = 25/70 (35.71%), Postives = 36/70 (51.43%), Query Frame = 0
BLAST of IVF0018241 vs. ExPASy Swiss-Prot
Match: Q7LHG5 (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2) HSP 1 Score: 47.0 bits (110), Expect = 1.1e-04 Identity = 25/70 (35.71%), Postives = 36/70 (51.43%), Query Frame = 0
BLAST of IVF0018241 vs. ExPASy TrEMBL
Match: A0A445LR48 (Transposon Ty3-G Gag-Pol polyprotein OS=Glycine soja OX=3848 GN=D0Y65_004303 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 1.5e-25 Identity = 61/82 (74.39%), Postives = 66/82 (80.49%), Query Frame = 0
BLAST of IVF0018241 vs. ExPASy TrEMBL
Match: A0A445EY74 (Reverse transcriptase OS=Glycine soja OX=3848 GN=D0Y65_055343 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 1.5e-25 Identity = 61/82 (74.39%), Postives = 66/82 (80.49%), Query Frame = 0
BLAST of IVF0018241 vs. ExPASy TrEMBL
Match: A0A392P218 (Reverse transcriptase domain-containing protein (Fragment) OS=Trifolium medium OX=97028 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 2.0e-25 Identity = 62/82 (75.61%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of IVF0018241 vs. ExPASy TrEMBL
Match: A0A445FCZ8 (Reverse transcriptase OS=Glycine soja OX=3848 GN=D0Y65_050671 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 2.0e-25 Identity = 61/82 (74.39%), Postives = 66/82 (80.49%), Query Frame = 0
BLAST of IVF0018241 vs. ExPASy TrEMBL
Match: A0A151QKV4 (Retrovirus-related Pol polyprotein from transposon 17.6 (Fragment) OS=Cajanus cajan OX=3821 GN=KK1_049680 PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 2.6e-25 Identity = 60/82 (73.17%), Postives = 66/82 (80.49%), Query Frame = 0
BLAST of IVF0018241 vs. NCBI nr
Match: RYA56915.1 (hypothetical protein DD596_25350, partial [Enterobacter cloacae complex sp. 4DZ3-28B]) HSP 1 Score: 125 bits (314), Expect = 2.66e-34 Identity = 61/82 (74.39%), Postives = 66/82 (80.49%), Query Frame = 0
BLAST of IVF0018241 vs. NCBI nr
Match: KYP49023.1 (Retrovirus-related Pol polyprotein from transposon 17.6 [Cajanus cajan]) HSP 1 Score: 123 bits (308), Expect = 4.34e-34 Identity = 59/82 (71.95%), Postives = 66/82 (80.49%), Query Frame = 0
BLAST of IVF0018241 vs. NCBI nr
Match: WP_165295147.1 (RNA-directed DNA polymerase, partial [Enterobacter cloacae complex sp. 4DZ3-28B]) HSP 1 Score: 125 bits (314), Expect = 4.58e-34 Identity = 61/82 (74.39%), Postives = 66/82 (80.49%), Query Frame = 0
BLAST of IVF0018241 vs. NCBI nr
Match: MCI06103.1 (hypothetical protein [Trifolium medium]) HSP 1 Score: 125 bits (313), Expect = 4.97e-33 Identity = 62/82 (75.61%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of IVF0018241 vs. NCBI nr
Match: KYP37139.1 (Retrovirus-related Pol polyprotein from transposon 297 family, partial [Cajanus cajan]) HSP 1 Score: 119 bits (298), Expect = 1.01e-32 Identity = 58/82 (70.73%), Postives = 65/82 (79.27%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|