IVF0009790 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATTCTTACTGTAAAAGACAAGAGTTAGAGTTCAGTACCATTGCTTTTCTCGTGGACGGCCATCCCATTGCTGGAACCCAAACCGCGGAAGAGGTTTTTCCAAGCTTTTTCTAAAAGGGGTTCTTTTTTTTTTTTTTTTTTAATTTAAATTTATTTTGATTTCAGTTTTTGTGTGGTCATGTTGGTTGATTTGGGTGTGATTCTCAGCTGGGGTTGGAAGATGGAGATGAAATTGATGCCATGAAACACCACTACGGCGGCGGCGGCGGCGGCGGAGCAATCTGA ATGTATTCTTACTGTAAAAGACAAGAGTTAGAGTTCAGTACCATTGCTTTTCTCGTGGACGGCCATCCCATTGCTGGAACCCAAACCGCGGAAGAGCTGGGGTTGGAAGATGGAGATGAAATTGATGCCATGAAACACCACTACGGCGGCGGCGGCGGCGGCGGAGCAATCTGA ATGTATTCTTACTGTAAAAGACAAGAGTTAGAGTTCAGTACCATTGCTTTTCTCGTGGACGGCCATCCCATTGCTGGAACCCAAACCGCGGAAGAGCTGGGGTTGGAAGATGGAGATGAAATTGATGCCATGAAACACCACTACGGCGGCGGCGGCGGCGGCGGAGCAATCTGA MYSYCKRQELEFSTIAFLVDGHPIAGTQTAEELGLEDGDEIDAMKHHYGGGGGGGAI Homology
BLAST of IVF0009790 vs. ExPASy Swiss-Prot
Match: P55852 (Small ubiquitin-related modifier 1 OS=Arabidopsis thaliana OX=3702 GN=SUMO1 PE=1 SV=2) HSP 1 Score: 64.7 bits (156), Expect = 3.9e-10 Identity = 30/54 (55.56%), Postives = 38/54 (70.37%), Query Frame = 0
BLAST of IVF0009790 vs. ExPASy Swiss-Prot
Match: Q9FLP6 (Small ubiquitin-related modifier 2 OS=Arabidopsis thaliana OX=3702 GN=SUMO2 PE=1 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.5e-09 Identity = 30/55 (54.55%), Postives = 38/55 (69.09%), Query Frame = 0
BLAST of IVF0009790 vs. ExPASy Swiss-Prot
Match: P55857 (Small ubiquitin-related modifier 1 OS=Oryza sativa subsp. japonica OX=39947 GN=SUMO1 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.5e-09 Identity = 28/50 (56.00%), Postives = 35/50 (70.00%), Query Frame = 0
BLAST of IVF0009790 vs. ExPASy Swiss-Prot
Match: Q9FLP5 (Small ubiquitin-related modifier 3 OS=Arabidopsis thaliana OX=3702 GN=SUMO3 PE=1 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.3e-05 Identity = 23/50 (46.00%), Postives = 31/50 (62.00%), Query Frame = 0
BLAST of IVF0009790 vs. ExPASy Swiss-Prot
Match: B3H5R8 (Putative small ubiquitin-related modifier 8 OS=Arabidopsis thaliana OX=3702 GN=SUMO8 PE=1 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 3.8e-05 Identity = 24/50 (48.00%), Postives = 31/50 (62.00%), Query Frame = 0
BLAST of IVF0009790 vs. ExPASy TrEMBL
Match: A0A5A7V249 (Small ubiquitin-related modifier 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1465G00130 PE=3 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 3.5e-22 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 0
BLAST of IVF0009790 vs. ExPASy TrEMBL
Match: A0A0A0KHV8 (Ubiquitin-like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G421070 PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 8.1e-19 Identity = 49/54 (90.74%), Postives = 51/54 (94.44%), Query Frame = 0
BLAST of IVF0009790 vs. ExPASy TrEMBL
Match: A0A6J1I0U8 (small ubiquitin-related modifier 1-like isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111468415 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 1.4e-15 Identity = 43/54 (79.63%), Postives = 46/54 (85.19%), Query Frame = 0
BLAST of IVF0009790 vs. ExPASy TrEMBL
Match: A0A6J1GLF8 (Small ubiquitin-related modifier OS=Cucurbita moschata OX=3662 GN=LOC111455344 PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 9.3e-15 Identity = 41/53 (77.36%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of IVF0009790 vs. ExPASy TrEMBL
Match: A0A6D2HY34 (Small ubiquitin-related modifier OS=Microthlaspi erraticum OX=1685480 GN=MERR_LOCUS8375 PE=3 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 9.0e-10 Identity = 34/56 (60.71%), Postives = 42/56 (75.00%), Query Frame = 0
BLAST of IVF0009790 vs. NCBI nr
Match: KAA0061648.1 (small ubiquitin-related modifier 1 [Cucumis melo var. makuwa] >TYK05858.1 small ubiquitin-related modifier 1 [Cucumis melo var. makuwa]) HSP 1 Score: 113 bits (282), Expect = 8.36e-31 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 0
BLAST of IVF0009790 vs. NCBI nr
Match: KGN47962.1 (hypothetical protein Csa_004132 [Cucumis sativus]) HSP 1 Score: 102 bits (253), Expect = 5.53e-27 Identity = 49/54 (90.74%), Postives = 51/54 (94.44%), Query Frame = 0
BLAST of IVF0009790 vs. NCBI nr
Match: XP_031743856.1 (small ubiquitin-related modifier 1-like [Cucumis sativus]) HSP 1 Score: 102 bits (253), Expect = 2.25e-26 Identity = 49/54 (90.74%), Postives = 51/54 (94.44%), Query Frame = 0
BLAST of IVF0009790 vs. NCBI nr
Match: XP_022969393.1 (small ubiquitin-related modifier 1-like isoform X2 [Cucurbita maxima]) HSP 1 Score: 91.3 bits (225), Expect = 4.86e-22 Identity = 43/54 (79.63%), Postives = 46/54 (85.19%), Query Frame = 0
BLAST of IVF0009790 vs. NCBI nr
Match: XP_023553983.1 (small ubiquitin-related modifier 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 89.0 bits (219), Expect = 3.86e-21 Identity = 41/53 (77.36%), Postives = 45/53 (84.91%), Query Frame = 0
BLAST of IVF0009790 vs. TAIR 10
Match: AT4G26840.1 (small ubiquitin-like modifier 1 ) HSP 1 Score: 64.7 bits (156), Expect = 2.8e-11 Identity = 30/54 (55.56%), Postives = 38/54 (70.37%), Query Frame = 0
BLAST of IVF0009790 vs. TAIR 10
Match: AT5G55160.1 (small ubiquitin-like modifier 2 ) HSP 1 Score: 62.8 bits (151), Expect = 1.0e-10 Identity = 30/55 (54.55%), Postives = 38/55 (69.09%), Query Frame = 0
BLAST of IVF0009790 vs. TAIR 10
Match: AT5G55160.2 (small ubiquitin-like modifier 2 ) HSP 1 Score: 62.8 bits (151), Expect = 1.0e-10 Identity = 30/55 (54.55%), Postives = 38/55 (69.09%), Query Frame = 0
BLAST of IVF0009790 vs. TAIR 10
Match: AT5G55170.1 (small ubiquitin-like modifier 3 ) HSP 1 Score: 49.7 bits (117), Expect = 9.2e-07 Identity = 23/50 (46.00%), Postives = 31/50 (62.00%), Query Frame = 0
BLAST of IVF0009790 vs. TAIR 10
Match: AT5G55856.1 (Ubiquitin-like superfamily protein ) HSP 1 Score: 48.1 bits (113), Expect = 2.7e-06 Identity = 24/50 (48.00%), Postives = 31/50 (62.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|