Sequences
The following sequences are available for this feature:
Legend: exon CDS polypeptide
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGTGGTAACGAAGGCTGTACACGAACGCACAAACGTAAGGAACGAGGATGGCGAATGGACGATGAACAAGCACAACAGTGACAGATGCAACGGTGGCTGGGCACGAGGGACGACGACAACTGTGTGCGCAGTGACTATTCGCCAGAGAAGAGAGGGTTGA
ATGGTGGTAACGAAGGCTGTACACGAACGCACAAACGTAAGGAACGAGGATGGCGAATGGACGATGAACAAGCACAACAGTGACAGATGCAACGGTGGCTGGGCACGAGGGACGACGACAACTGTGTGCGCAGTGACTATTCGCCAGAGAAGAGAGGGTTGA
ATGGTGGTAACGAAGGCTGTACACGAACGCACAAACGTAAGGAACGAGGATGGCGAATGGACGATGAACAAGCACAACAGTGACAGATGCAACGGTGGCTGGGCACGAGGGACGACGACAACTGTGTGCGCAGTGACTATTCGCCAGAGAAGAGAGGGTTGA
MVVTKAVHERTNVRNEDGEWTMNKHNSDRCNGGWARGTTTTVCAVTIRQRREG
Homology
BLAST of IVF0009318 vs. ExPASy TrEMBL
Match:
A0A5D3BNP4 (CCHC-type domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold602G00460 PE=4 SV=1)
HSP 1 Score: 63.2 bits (152), Expect = 3.9e-07
Identity = 30/44 (68.18%), Postives = 35/44 (79.55%), Query Frame = 0
BLAST of IVF0009318 vs. NCBI nr
Match:
TYK00887.1 (uncharacterized protein E5676_scaffold602G00460 [Cucumis melo var. makuwa])
HSP 1 Score: 65.1 bits (157), Expect = 1.77e-10
Identity = 30/44 (68.18%), Postives = 35/44 (79.55%), Query Frame = 0
The following BLAST results are available for this feature:
Match Name E-value Identity Description
Match Name E-value Identity Description
A0A5D3BNP4 3.9e-07 68.18 CCHC-type domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5... [more]
Match Name E-value Identity Description
TYK00887.1 1.77e-10 68.18 uncharacterized protein E5676_scaffold602G00460 [Cucumis melo var. makuwa] [more]
Match Name E-value Identity Description
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
A T G G T G G T A A C G A A G G C T G T A C A C G A A C G C A C A A A C G T A A G G A A C G A G G A T G G C G A A T G G A C G A T G A A C A A G C A C A A C A G T G A C A G A T G C A A C G G T G G C T G G G C A C G A G G G A C G A C G A C A A C T G T G T G C G C A G T G A C T A T T C G C C A G A G A A G A G A G G G T T G A 20 40 60 80 100 120 140 160 Score = Sequence mobidb-lite
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 1..20
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category
Term Accession
Term Name
molecular_function
GO:0003676 nucleic acid binding
molecular_function
GO:0008270 zinc ion binding
