Sequences
The following sequences are available for this feature:
Legend: exon CDS polypeptide
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGCACAAAAACGTCGATGGAAGTGGAAAAGACGTCGGGAAATCAATTTCCGACATAGAAGGGAACGTCGAAAAGACCGTCGGAAGAAACGCATTGGGAGACCTTTTCCCGACGCGTCACCAACAAAGCATTGGGAATAACCTTCTCTCGACGTTTTCTTCACCAACAAAGTAA
ATGCACAAAAACGTCGATGGAAGTGGAAAAGACGTCGGGAAATCAATTTCCGACATAGAAGGGAACGTCGAAAAGACCGTCGGAAGAAACGCATTGGGAGACCTTTTCCCGACGCGTCACCAACAAAGCATTGGGAATAACCTTCTCTCGACGTTTTCTTCACCAACAAAGTAA
ATGCACAAAAACGTCGATGGAAGTGGAAAAGACGTCGGGAAATCAATTTCCGACATAGAAGGGAACGTCGAAAAGACCGTCGGAAGAAACGCATTGGGAGACCTTTTCCCGACGCGTCACCAACAAAGCATTGGGAATAACCTTCTCTCGACGTTTTCTTCACCAACAAAGTAA
MHKNVDGSGKDVGKSISDIEGNVEKTVGRNALGDLFPTRHQQSIGNNLLSTFSSPTK
Homology
BLAST of IVF0007815 vs. ExPASy TrEMBL
Match:
A0A5A7TBZ3 (Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1441G00370 PE=4 SV=1)
HSP 1 Score: 69.3 bits (168), Expect = 5.8e-09
Identity = 33/53 (62.26%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of IVF0007815 vs. ExPASy TrEMBL
Match:
A0A5A7T7S7 (Retrotransposon protein, putative, Ty3-gypsy subclass OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold2967G00080 PE=4 SV=1)
HSP 1 Score: 57.8 bits (138), Expect = 1.8e-05
Identity = 30/55 (54.55%), Postives = 33/55 (60.00%), Query Frame = 0
BLAST of IVF0007815 vs. NCBI nr
Match:
KAA0039107.1 (hypothetical protein E6C27_scaffold84G002100 [Cucumis melo var. makuwa] >TYK25976.1 hypothetical protein E5676_scaffold1441G00370 [Cucumis melo var. makuwa])
HSP 1 Score: 67.8 bits (164), Expect = 5.51e-13
Identity = 33/53 (62.26%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of IVF0007815 vs. NCBI nr
Match:
KAA0038928.1 (retrotransposon protein, putative, Ty3-gypsy subclass [Cucumis melo var. makuwa])
HSP 1 Score: 56.2 bits (134), Expect = 2.19e-07
Identity = 30/55 (54.55%), Postives = 33/55 (60.00%), Query Frame = 0
The following BLAST results are available for this feature:
Match Name E-value Identity Description
Match Name E-value Identity Description
A0A5A7TBZ3 5.8e-09 62.26 Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold... [more] A0A5A7T7S7 1.8e-05 54.55 Retrotransposon protein, putative, Ty3-gypsy subclass OS=Cucumis melo var. makuw... [more]
Match Name E-value Identity Description
KAA0039107.1 5.51e-13 62.26 hypothetical protein E6C27_scaffold84G002100 [Cucumis melo var. makuwa] >TYK2597... [more] KAA0038928.1 2.19e-07 54.55 retrotransposon protein, putative, Ty3-gypsy subclass [Cucumis melo var. makuwa] [more]
Match Name E-value Identity Description
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
A T G C A C A A A A A C G T C G A T G G A A G T G G A A A A G A C G T C G G G A A A T C A A T T T C C G A C A T A G A A G G G A A C G T C G A A A A G A C C G T C G G A A G A A A C G C A T T G G G A G A C C T T T T C C C G A C G C G T C A C C A A C A A A G C A T T G G G A A T A A C C T T C T C T C G A C G T T T T C T T C A C C A A C A A A G T A A 20 40 60 80 100 120 140 160 Score = Score = Sequence mobidb-lite mobidb-lite
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 1..24 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 37..57
Relationships
The following mRNA feature(s) are a part of this gene:
