IVF0004409 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCGATGGCGAGGGCGAGCTCCGGCTTACAATATCCTGACCGATTCTACGTCGCGGCTTCTTATGCCGATTTTGATGGATCACCAAAATCGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCGCTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACGTGTTCTTACACCTGTGACTTATCGGTGTTGTTTCAGTTTGGTTGAGGTTTGA ATGGCTGCGATGGCGAGGGCGAGCTCCGGCTTACAATATCCTGACCGATTCTACGTCGCGGCTTCTTATGCCGATTTTGATGGATCACCAAAATCGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCGCTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACGTGTTCTTACACCTGTGACTTATCGGTGTTGTTTCAGTTTGGTTGAGGTTTGA ATGGCTGCGATGGCGAGGGCGAGCTCCGGCTTACAATATCCTGACCGATTCTACGTCGCGGCTTCTTATGCCGATTTTGATGGATCACCAAAATCGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCGCTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACGTGTTCTTACACCTGTGACTTATCGGTGTTGTTTCAGTTTGGTTGAGGTTTGA MAAMARASSGLQYPDRFYVAASYADFDGSPKSSSKALRSKFSDEAALLLYGLYQQVLPRVLTPVTYRCCFSLVEV Homology
BLAST of IVF0004409 vs. ExPASy Swiss-Prot
Match: Q8RWD9 (Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=ACBP5 PE=1 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.3e-10 Identity = 36/55 (65.45%), Postives = 42/55 (76.36%), Query Frame = 0
BLAST of IVF0004409 vs. ExPASy Swiss-Prot
Match: Q9MA55 (Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=ACBP4 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.3e-09 Identity = 34/53 (64.15%), Postives = 39/53 (73.58%), Query Frame = 0
BLAST of IVF0004409 vs. ExPASy Swiss-Prot
Match: Q75LJ4 (Acyl-CoA-binding domain-containing protein 6 OS=Oryza sativa subsp. japonica OX=39947 GN=ACBP6 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.6e-08 Identity = 35/66 (53.03%), Postives = 41/66 (62.12%), Query Frame = 0
BLAST of IVF0004409 vs. ExPASy TrEMBL
Match: A0A5D3C7Q0 (Acyl-CoA-binding domain-containing protein 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1702G00220 PE=4 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 6.4e-32 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of IVF0004409 vs. ExPASy TrEMBL
Match: A0A5A7TXT8 (Acyl-CoA-binding domain-containing protein 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold488G00610 PE=3 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 7.1e-31 Identity = 72/75 (96.00%), Postives = 73/75 (97.33%), Query Frame = 0
BLAST of IVF0004409 vs. ExPASy TrEMBL
Match: A0A5D3CJT5 (Acyl-CoA-binding domain-containing protein 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold828G00570 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 1.8e-29 Identity = 70/74 (94.59%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of IVF0004409 vs. ExPASy TrEMBL
Match: A0A5D3C6F7 (Acyl-CoA-binding domain-containing protein 4 isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold202G002100 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 5.1e-29 Identity = 69/74 (93.24%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of IVF0004409 vs. ExPASy TrEMBL
Match: A0A5A7VFV5 (Acyl-CoA-binding domain-containing protein 4 isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold979G00450 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 5.1e-29 Identity = 69/74 (93.24%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of IVF0004409 vs. NCBI nr
Match: TYK07505.1 (acyl-CoA-binding domain-containing protein 4 [Cucumis melo var. makuwa]) HSP 1 Score: 145 bits (367), Expect = 5.34e-42 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of IVF0004409 vs. NCBI nr
Match: KAA0063418.1 (acyl-CoA-binding domain-containing protein 4 [Cucumis melo var. makuwa] >TYK11680.1 acyl-CoA-binding domain-containing protein 4 [Cucumis melo var. makuwa]) HSP 1 Score: 137 bits (346), Expect = 7.59e-40 Identity = 70/74 (94.59%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of IVF0004409 vs. NCBI nr
Match: KAA0025187.1 (acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa] >TYK07477.1 acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 136 bits (342), Expect = 9.47e-40 Identity = 69/74 (93.24%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of IVF0004409 vs. NCBI nr
Match: KAA0031885.1 (acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 136 bits (342), Expect = 2.14e-39 Identity = 69/74 (93.24%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of IVF0004409 vs. NCBI nr
Match: KAA0066628.1 (acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 136 bits (342), Expect = 2.14e-39 Identity = 69/74 (93.24%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of IVF0004409 vs. TAIR 10
Match: AT5G27630.1 (acyl-CoA binding protein 5 ) HSP 1 Score: 65.9 bits (159), Expect = 1.6e-11 Identity = 36/55 (65.45%), Postives = 42/55 (76.36%), Query Frame = 0
BLAST of IVF0004409 vs. TAIR 10
Match: AT3G05420.1 (acyl-CoA binding protein 4 ) HSP 1 Score: 62.0 bits (149), Expect = 2.4e-10 Identity = 34/53 (64.15%), Postives = 39/53 (73.58%), Query Frame = 0
BLAST of IVF0004409 vs. TAIR 10
Match: AT3G05420.2 (acyl-CoA binding protein 4 ) HSP 1 Score: 62.0 bits (149), Expect = 2.4e-10 Identity = 34/53 (64.15%), Postives = 39/53 (73.58%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|