HG10020312 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGTGCTGTGGTGGAAACTGTGGGTGCGGCTCTGCCTGCAAGTGCGGAAGTGGCTGTGGAGGGTGAGTAATCGCTAATTTTTCCTTTGAATTTGATCGCGTGGAATTGCTTTTTGTTAACTTGATATATTCTGTGGAAAATGATCTCTCGATAATCTGATCTTCTGTTTTCTTGCATATCGCTTTCAATTTCTTAATCTTCTCTGCATCTTTGTTCTTCGCTCGATGGCGATCTGATCATTCGCCGATTATCTTCATCGAGTTCTGGAGTTGAGAAAGATCGCGCGATCAAGGCGGATTTTCTTCTGAAATTTCTGAAAACGACTCCGATATTCATTTTCCAGAGGATAATCGCGATGATTTTGACGTTTTGATCTTTTGTTATGCAGATGCAAGATGTTCCCTGACATGAGCTTCTCAGAGACCACCGCTACCATCGAGACCTTCGTAGTCGGTTTCGCTCCTCAGAAGATGTAAGTTTCTTCAATTACGCCTAATTTTTCAAGAGAAATTTAGGTATTTAGTCATGATTTTATTTAACGGTATCGGCGTTTTCGATATCAGGTCCTTCGAGGTAGCAGAGATGGGAGCTGAGAACGGCTGCAAGTGCGGTGACAACTGCACCTGCGATCCATGCAACTGTAAATGA ATGTCGTGCTGTGGTGGAAACTGTGGGTGCGGCTCTGCCTGCAAGTGCGGAAGTGGCTGTGGAGGATGCAAGATGTTCCCTGACATGAGCTTCTCAGAGACCACCGCTACCATCGAGACCTTCGTAGTCGGTTTCGCTCCTCAGAAGATGTCCTTCGAGGTAGCAGAGATGGGAGCTGAGAACGGCTGCAAGTGCGGTGACAACTGCACCTGCGATCCATGCAACTGTAAATGA ATGTCGTGCTGTGGTGGAAACTGTGGGTGCGGCTCTGCCTGCAAGTGCGGAAGTGGCTGTGGAGGATGCAAGATGTTCCCTGACATGAGCTTCTCAGAGACCACCGCTACCATCGAGACCTTCGTAGTCGGTTTCGCTCCTCAGAAGATGTCCTTCGAGGTAGCAGAGATGGGAGCTGAGAACGGCTGCAAGTGCGGTGACAACTGCACCTGCGATCCATGCAACTGTAAATGA MSCCGGNCGCGSACKCGSGCGGCKMFPDMSFSETTATIETFVVGFAPQKMSFEVAEMGAENGCKCGDNCTCDPCNCK Homology
BLAST of HG10020312 vs. NCBI nr
Match: XP_038906044.1 (metallothionein-like protein type 2 [Benincasa hispida]) HSP 1 Score: 166.8 bits (421), Expect = 7.5e-38 Identity = 76/77 (98.70%), Postives = 76/77 (98.70%), Query Frame = 0
BLAST of HG10020312 vs. NCBI nr
Match: XP_022949247.1 (metallothionein-like protein type 2 [Cucurbita moschata] >XP_022971579.1 metallothionein-like protein type 2 [Cucurbita maxima] >XP_023538679.1 metallothionein-like protein type 2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 164.9 bits (416), Expect = 2.8e-37 Identity = 75/77 (97.40%), Postives = 76/77 (98.70%), Query Frame = 0
BLAST of HG10020312 vs. NCBI nr
Match: KAG6596409.1 (Metallothionein-like protein type 2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7027952.1 Metallothionein-like protein type 2 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 163.3 bits (412), Expect = 8.3e-37 Identity = 74/77 (96.10%), Postives = 76/77 (98.70%), Query Frame = 0
BLAST of HG10020312 vs. NCBI nr
Match: BAD26571.1 (type-2 metallothionein [Citrullus lanatus]) HSP 1 Score: 162.9 bits (411), Expect = 1.1e-36 Identity = 74/77 (96.10%), Postives = 74/77 (96.10%), Query Frame = 0
BLAST of HG10020312 vs. NCBI nr
Match: XP_022934858.1 (metallothionein-like protein type 2 B [Cucurbita moschata] >XP_023529118.1 metallothionein-like protein type 2 B [Cucurbita pepo subsp. pepo] >KAG6580545.1 Metallothionein-like protein type 2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7017297.1 Metallothionein-like protein type 2 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 162.2 bits (409), Expect = 1.8e-36 Identity = 73/77 (94.81%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of HG10020312 vs. ExPASy Swiss-Prot
Match: Q40158 (Metallothionein-like protein type 2 B OS=Solanum lycopersicum OX=4081 GN=MTB PE=2 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.4e-26 Identity = 53/80 (66.25%), Postives = 64/80 (80.00%), Query Frame = 0
BLAST of HG10020312 vs. ExPASy Swiss-Prot
Match: P30564 (Metallothionein-like protein type 2 OS=Ricinus communis OX=3988 GN=MTI PE=3 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.4e-26 Identity = 57/81 (70.37%), Postives = 62/81 (76.54%), Query Frame = 0
BLAST of HG10020312 vs. ExPASy Swiss-Prot
Match: P43390 (Metallothionein-like protein type 2 OS=Actinidia deliciosa OX=3627 GN=pKIWI504 PE=2 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.1e-26 Identity = 56/79 (70.89%), Postives = 63/79 (79.75%), Query Frame = 0
BLAST of HG10020312 vs. ExPASy Swiss-Prot
Match: Q39459 (Metallothionein-like protein 2 OS=Cicer arietinum OX=3827 PE=3 SV=2) HSP 1 Score: 118.2 bits (295), Expect = 4.0e-26 Identity = 59/80 (73.75%), Postives = 65/80 (81.25%), Query Frame = 0
BLAST of HG10020312 vs. ExPASy Swiss-Prot
Match: Q41657 (Metallothionein-like protein type 2 OS=Vicia faba OX=3906 GN=MTI PE=2 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 5.2e-26 Identity = 54/78 (69.23%), Postives = 65/78 (83.33%), Query Frame = 0
BLAST of HG10020312 vs. ExPASy TrEMBL
Match: A0A6J1I8Z4 (metallothionein-like protein type 2 OS=Cucurbita maxima OX=3661 GN=LOC111470252 PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 1.4e-37 Identity = 75/77 (97.40%), Postives = 76/77 (98.70%), Query Frame = 0
BLAST of HG10020312 vs. ExPASy TrEMBL
Match: A0A6J1GBI9 (metallothionein-like protein type 2 OS=Cucurbita moschata OX=3662 GN=LOC111452655 PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 1.4e-37 Identity = 75/77 (97.40%), Postives = 76/77 (98.70%), Query Frame = 0
BLAST of HG10020312 vs. ExPASy TrEMBL
Match: Q6I674 (Type-2 metallothionein OS=Citrullus lanatus OX=3654 GN=CLMT2 PE=2 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 5.2e-37 Identity = 74/77 (96.10%), Postives = 74/77 (96.10%), Query Frame = 0
BLAST of HG10020312 vs. ExPASy TrEMBL
Match: A0A6J1F8X2 (metallothionein-like protein type 2 B OS=Cucurbita moschata OX=3662 GN=LOC111441898 PE=3 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 8.9e-37 Identity = 73/77 (94.81%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of HG10020312 vs. ExPASy TrEMBL
Match: A0A1S3B6L7 (metallothionein-like protein type 2 OS=Cucumis melo OX=3656 GN=LOC103486389 PE=3 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 3.4e-36 Identity = 72/77 (93.51%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of HG10020312 vs. TAIR 10
Match: AT3G09390.1 (metallothionein 2A ) HSP 1 Score: 107.1 bits (266), Expect = 6.5e-24 Identity = 52/81 (64.20%), Postives = 59/81 (72.84%), Query Frame = 0
BLAST of HG10020312 vs. TAIR 10
Match: AT5G02380.1 (metallothionein 2B ) HSP 1 Score: 89.4 bits (220), Expect = 1.4e-18 Identity = 46/81 (56.79%), Postives = 55/81 (67.90%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|