Csor.00g009040 (gene) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSsinglestart_codonpolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGACGAAAGCAAGGCTCTCTCTGATCGCCGTCGTGGTGCTGGCGCTGCTGGAGGTGGCGGTTCTGGCGGAAGGATACAGCGGAAGAATAGGCGGACGAAGAAGAATCAAAGACGTGAGGAGCAACGAGGAGGTGCAGGGATTAGGGAGGTTCAGCGTGGAGGAGTACAATCGGAGATCGCGGCGGAGTGGAGGCGGAGAGGTGGAGTTCTTGGCGGTGTTGGTGGCGGAGAGGCAGGTGGTGGCCGGAACGAAGTATTACTTGAGGATCTTGGGGATTGAGAACGGTCGGAAGAGGATTTTTGAATCGGTTGTGGTCGTGAAGCCGTGGCTAAGGTCTAAGCAGCTTATCGATTTCTCGGCGTCGAGATTGTTTCCGAGTAGGATTTCAAATTTCTGA ATGACGAAAGCAAGGCTCTCTCTGATCGCCGTCGTGGTGCTGGCGCTGCTGGAGGTGGCGGTTCTGGCGGAAGGATACAGCGGAAGAATAGGCGGACGAAGAAGAATCAAAGACGTGAGGAGCAACGAGGAGGTGCAGGGATTAGGGAGGTTCAGCGTGGAGGAGTACAATCGGAGATCGCGGCGGAGTGGAGGCGGAGAGGTGGAGTTCTTGGCGGTGTTGGTGGCGGAGAGGCAGGTGGTGGCCGGAACGAAGTATTACTTGAGGATCTTGGGGATTGAGAACGGTCGGAAGAGGATTTTTGAATCGGTTGTGGTCGTGAAGCCGTGGCTAAGGTCTAAGCAGCTTATCGATTTCTCGGCGTCGAGATTGTTTCCGAGTAGGATTTCAAATTTCTGA ATGACGAAAGCAAGGCTCTCTCTGATCGCCGTCGTGGTGCTGGCGCTGCTGGAGGTGGCGGTTCTGGCGGAAGGATACAGCGGAAGAATAGGCGGACGAAGAAGAATCAAAGACGTGAGGAGCAACGAGGAGGTGCAGGGATTAGGGAGGTTCAGCGTGGAGGAGTACAATCGGAGATCGCGGCGGAGTGGAGGCGGAGAGGTGGAGTTCTTGGCGGTGTTGGTGGCGGAGAGGCAGGTGGTGGCCGGAACGAAGTATTACTTGAGGATCTTGGGGATTGAGAACGGTCGGAAGAGGATTTTTGAATCGGTTGTGGTCGTGAAGCCGTGGCTAAGGTCTAAGCAGCTTATCGATTTCTCGGCGTCGAGATTGTTTCCGAGTAGGATTTCAAATTTCTGA MTKARLSLIAVVVLALLEVAVLAEGYSGRIGGRRRIKDVRSNEEVQGLGRFSVEEYNRRSRRSGGGEVEFLAVLVAERQVVAGTKYYLRILGIENGRKRIFESVVVVKPWLRSKQLIDFSASRLFPSRISNF Homology
BLAST of Csor.00g009040 vs. ExPASy Swiss-Prot
Match: Q5N806 (Cysteine proteinase inhibitor 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0915200 PE=2 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 5.6e-20 Identity = 54/112 (48.21%), Postives = 72/112 (64.29%), Query Frame = 0
BLAST of Csor.00g009040 vs. ExPASy Swiss-Prot
Match: Q10993 (Cysteine proteinase inhibitor B OS=Helianthus annuus OX=4232 PE=1 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.2e-17 Identity = 44/92 (47.83%), Postives = 71/92 (77.17%), Query Frame = 0
BLAST of Csor.00g009040 vs. ExPASy Swiss-Prot
Match: A2XS65 (Cysteine proteinase inhibitor 10 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_014908 PE=3 SV=2) HSP 1 Score: 86.7 bits (213), Expect = 2.2e-16 Identity = 47/107 (43.93%), Postives = 67/107 (62.62%), Query Frame = 0
BLAST of Csor.00g009040 vs. ExPASy Swiss-Prot
Match: P0C579 (Cysteine proteinase inhibitor 10 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0350100 PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 2.2e-16 Identity = 47/107 (43.93%), Postives = 67/107 (62.62%), Query Frame = 0
BLAST of Csor.00g009040 vs. ExPASy Swiss-Prot
Match: Q8L5T9 (Cysteine proteinase inhibitor 2 OS=Arabidopsis thaliana OX=3702 GN=CYS2 PE=2 SV=2) HSP 1 Score: 80.1 bits (196), Expect = 2.1e-14 Identity = 50/130 (38.46%), Postives = 81/130 (62.31%), Query Frame = 0
BLAST of Csor.00g009040 vs. NCBI nr
Match: KAG6592889.1 (hypothetical protein SDJN03_12365, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 247 bits (630), Expect = 3.74e-82 Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 0
BLAST of Csor.00g009040 vs. NCBI nr
Match: KAG7025292.1 (hypothetical protein SDJN02_11787, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 245 bits (625), Expect = 2.16e-81 Identity = 130/132 (98.48%), Postives = 132/132 (100.00%), Query Frame = 0
BLAST of Csor.00g009040 vs. NCBI nr
Match: XP_022960190.1 (cysteine proteinase inhibitor B [Cucurbita moschata]) HSP 1 Score: 244 bits (623), Expect = 4.37e-81 Identity = 131/132 (99.24%), Postives = 131/132 (99.24%), Query Frame = 0
BLAST of Csor.00g009040 vs. NCBI nr
Match: XP_023513886.1 (cysteine proteinase inhibitor B [Cucurbita pepo subsp. pepo]) HSP 1 Score: 239 bits (610), Expect = 4.20e-79 Identity = 128/132 (96.97%), Postives = 129/132 (97.73%), Query Frame = 0
BLAST of Csor.00g009040 vs. NCBI nr
Match: XP_023005096.1 (cysteine proteinase inhibitor B-like [Cucurbita maxima]) HSP 1 Score: 233 bits (595), Expect = 8.13e-77 Identity = 123/132 (93.18%), Postives = 130/132 (98.48%), Query Frame = 0
BLAST of Csor.00g009040 vs. ExPASy TrEMBL
Match: A0A6J1H8E3 (cysteine proteinase inhibitor B OS=Cucurbita moschata OX=3662 GN=LOC111461002 PE=4 SV=1) HSP 1 Score: 244 bits (623), Expect = 2.11e-81 Identity = 131/132 (99.24%), Postives = 131/132 (99.24%), Query Frame = 0
BLAST of Csor.00g009040 vs. ExPASy TrEMBL
Match: A0A6J1KTZ7 (cysteine proteinase inhibitor B-like OS=Cucurbita maxima OX=3661 GN=LOC111498186 PE=4 SV=1) HSP 1 Score: 233 bits (595), Expect = 3.94e-77 Identity = 123/132 (93.18%), Postives = 130/132 (98.48%), Query Frame = 0
BLAST of Csor.00g009040 vs. ExPASy TrEMBL
Match: A0A0A0KC20 (Cystatin OS=Cucumis sativus OX=3659 GN=Csa_6G022340 PE=4 SV=1) HSP 1 Score: 160 bits (404), Expect = 4.37e-48 Identity = 86/132 (65.15%), Postives = 106/132 (80.30%), Query Frame = 0
BLAST of Csor.00g009040 vs. ExPASy TrEMBL
Match: A0A1S3CPD1 (cysteine proteinase inhibitor B OS=Cucumis melo OX=3656 GN=LOC103503076 PE=4 SV=1) HSP 1 Score: 155 bits (392), Expect = 2.92e-46 Identity = 80/132 (60.61%), Postives = 104/132 (78.79%), Query Frame = 0
BLAST of Csor.00g009040 vs. ExPASy TrEMBL
Match: A0A6J1DAN3 (cysteine proteinase inhibitor B OS=Momordica charantia OX=3673 GN=LOC111018574 PE=4 SV=1) HSP 1 Score: 136 bits (343), Expect = 8.26e-39 Identity = 74/125 (59.20%), Postives = 93/125 (74.40%), Query Frame = 0
BLAST of Csor.00g009040 vs. TAIR 10
Match: AT2G31980.1 (PHYTOCYSTATIN 2 ) HSP 1 Score: 80.1 bits (196), Expect = 1.5e-15 Identity = 50/130 (38.46%), Postives = 81/130 (62.31%), Query Frame = 0
BLAST of Csor.00g009040 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 64.7 bits (156), Expect = 6.4e-11 Identity = 36/102 (35.29%), Postives = 64/102 (62.75%), Query Frame = 0
BLAST of Csor.00g009040 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 64.7 bits (156), Expect = 6.4e-11 Identity = 36/102 (35.29%), Postives = 64/102 (62.75%), Query Frame = 0
BLAST of Csor.00g009040 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 59.7 bits (143), Expect = 2.1e-09 Identity = 36/117 (30.77%), Postives = 65/117 (55.56%), Query Frame = 0
BLAST of Csor.00g009040 vs. TAIR 10
Match: AT5G05110.1 (Cystatin/monellin family protein ) HSP 1 Score: 59.3 bits (142), Expect = 2.7e-09 Identity = 37/92 (40.22%), Postives = 52/92 (56.52%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|