Cp4.1LG11g04490 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.CACAGGCTTGGGTCGGACCGGGAGGCCCTATATAAAGGGGTTTGGTTCCCCATTCTTCGCATTCATCCGTATTTTGAAAGAAATCCCTATCTATCCGAGGACGAAAATTCTCTCTAGCGTGTCAAGCCCCTCCTCTTCTTCCAGGTTAGTTCATCGTCGTCTCGTTTATCCGACTTATTTTCTTGTGATTGATTAGTATTATTCGGTTTTCCTTTCAATTTCATTCCTGGAGGATATGGTTGATCTTCTGCTCGAATTCGTTCTAATCGAATGTAGTTTACGGTTAGGGTTAGTTTTTCTTCTGGAATTTATTTCTCGAACTTTGAGGTTTGTTGATAACTAATCTGTAGAAACCTCTACATAGTCGAAGAACTTGTGCTTTTATCCGTGAAAAGTTTTAGGAGAGGAATGGGGAGAAGTAGGTCAAATAATCTCATATTCGCAGGCTAAATGCTGGTTAGGTTTAGTAGCTACTTCTAATTTATAGGTTTTTTGGAACAATCAATCGTCAGATTCAGATATATCTGTTCATTCTAATTTGGAAGCGGAGACGCACTTTACATTTGAATTATCTTAGCGATCTGTTTTGTTTTGATTGAGCGACGATATTTAATTCGCACGACATTGATTCAGATGGCTCGTACGAAGCAAACTGCTCGCAAATCCACAGGTGGAAAGGCTCCCAGAAAGCAGCTTGCTACCAAGGTATTTTCTAGGATGATAGCAAGCAACCTAGTTCTGAATTCTCATTTGTTTCCTGACCTAATGTATTGTAAATCTGACCAATATTTTGCCAGGCTGCGCGTAAGTCGGCACCCACTACTGGAGGCGTGAAGAAGCCACACAGATACCGCCCAGGAACAGTTGCTCTTCGGTATGTTACCACATCTGATCTTTACTTTACACATTCGAAAAAATCAACCATGGTTTCTTGTTTACATGAATCTTATGCCCTCTGTAATGTATGTGATACAGAGAAATCCGCAAGTACCAGAAGAGTACTGAGCTTCTTATCCGCAAGCTCCCATTCCAGAGGCTTGTCCGAGAAATCGCACAAGATTTCAAGACAGATCTGCGTTTCCAGAGCCACGCGGTTTTGGCGTTGCAAGAGGCGGCTGAAGCTTACCTCGTTGGGCTGTTTGAAGATACCAATCTCTGCGCCATTCATGCCAAGCGTGTTACAATAATGCCGAAAGATATTCAACTTGCCAGAAGAATCCGTGGTGAAAGAGCTTAACCAGAATCTCCAGATTATAAGAACTATGCGTCGATCTATAAATGTTTTTTATTTTTATTTTTTTTCTTTTTTACGCTCCAATTGCAATCAATGTGTAAATTGTGTTTTGATAATAAACACAATCCTAGTTATACATTTAAGGACATTGTTATTTGTGTCAACTACGATCCTCAGCGGAATTCAAATCGAGTCCTTCGTTGACACATCTAAGTAATTGATTATATGTTCTTGGTTAAATGCTATGTTTAATTATATCTTTTACTTTGAAGAGTTTTTACTTGTCTGGATTTAAATTCGTTCAAGAATTTGTACATTTACACCAAAAACTCATATGAAAATTACGTTGTGAGGGTAATTCGTGTAGATATTGTTTTTATTTTCTGCATCAATTTCTTCTTTTAAACAACACAACTTCCATCTTGGTTTCAGGACGGATCTCCATCAACTTTAGAATGTGCAAGGCTCTGGTCAGAAGAATGGCTCGAGAACAAAGAGAATAGCTAACTACAGTTTATTAGAATTTTCATAAAAGCATGTATCAGTGCATCCGATATGGGTCTTACAGGAGTGGTTAGGTTCCAACTCCAAGTAGCCATTGATGAAACATGATCTAAATATGGAAAAACCATTTGGTACTGAATCAACAAAACTTGCTTGCAAATGGATTTGAATAATAAAGAACAAAACCAGCCGAAAATTATTAACTCAATTGTTTGATAGAGACAACATTCTCCAGTTTATTTGCCTGTCTTACGGCAGCGTGAGCCAAACTGCTGATGAATTTTCGAATAGACAACACTCCTACAGCGGACCTGGGAAGCATCCGTTCTCCCTCTGCTCATTCCACTTCTCTACCTGCAACAGTTATTAAAGAATGCGTTACTAAGAGAAATTATCATGTCAAATTTTGATGTGCTTTTGCCAGAATTCGTCGAGAAAGTAATGCTTTGATTGATTAACTATGAGTAGAGATACGTATGAACATCGAGCTCGTGCCCGGTGTTGGTGAAATGACAAACATAAAGGTCTTATAGAGCACATTTTACATCAAGCATATGGCTGACTTTAATCTCCCACT CACAGGCTTGGGTCGGACCGGGAGGCCCTATATAAAGGGGTTTGGTTCCCCATTCTTCGCATTCATCCGTATTTTGAAAGAAATCCCTATCTATCCGAGGACGAAAATTCTCTCTAGCGTGTCAAGCCCCTCCTCTTCTTCCAGATGGCTCGTACGAAGCAAACTGCTCGCAAATCCACAGGTGGAAAGGCTCCCAGAAAGCAGCTTGCTACCAAGGCTGCGCGTAAGTCGGCACCCACTACTGGAGGCGTGAAGAAGCCACACAGATACCGCCCAGGAACAGTTGCTCTTCGAGAAATCCGCAAGTACCAGAAGAGTACTGAGCTTCTTATCCGCAAGCTCCCATTCCAGAGGCTTGTCCGAGAAATCGCACAAGATTTCAAGACAGATCTGCGTTTCCAGAGCCACGCGGTTTTGGCGTTGCAAGAGGCGGCTGAAGCTTACCTCGTTGGGCTGTTTGAAGATACCAATCTCTGCGCCATTCATGCCAAGCGTGTTACAATAATGCCGAAAGATATTCAACTTGCCAGAAGAATCCGTGGTGAAAGAGCTTAACCAGAATCTCCAGATTATAAGAACTATGCGTCGATCTATAAATGTTTTTTATTTTTATTTTTTTTCTTTTTTACGCTCCAATTGCAATCAATGTGTAAATTGTGTTTTGATAATAAACACAATCCTAGTTATACATTTAAGGACATTGTTATTTGTGTCAACTACGATCCTCAGCGGAATTCAAATCGAGTCCTTCGTTGACACATCTAAGTAATTGATTATATGTTCTTGGTTAAATGCTATGTTTAATTATATCTTTTACTTTGAAGAGTTTTTACTTGTCTGGATTTAAATTCGTTCAAGAATTTGTACATTTACACCAAAAACTCATATGAAAATTACGTTGTGAGGGTAATTCGTGTAGATATTGTTTTTATTTTCTGCATCAATTTCTTCTTTTAAACAACACAACTTCCATCTTGGTTTCAGGACGGATCTCCATCAACTTTAGAATGTGCAAGGCTCTGGTCAGAAGAATGGCTCGAGAACAAAGAGAATAGCTAACTACAGTTTATTAGAATTTTCATAAAAGCATGTATCAGTGCATCCGATATGGGTCTTACAGGAGTGGTTAGGTTCCAACTCCAAGTAGCCATTGATGAAACATGATCTAAATATGGAAAAACCATTTGGTACTGAATCAACAAAACTTGCTTGCAAATGGATTTGAATAATAAAGAACAAAACCAGCCGAAAATTATTAACTCAATTGTTTGATAGAGACAACATTCTCCAGTTTATTTGCCTGTCTTACGGCAGCGTGAGCCAAACTGCTGATGAATTTTCGAATAGACAACACTCCTACAGCGGACCTGGGAAGCATCCGTTCTCCCTCTGCTCATTCCACTTCTCTACCTGCAACAGTTATTAAAGAATGCGTTACTAAGAGAAATTATCATGTCAAATTTTGATGTGCTTTTGCCAGAATTCGTCGAGAAAGTAATGCTTTGATTGATTAACTATGAGTAGAGATACGTATGAACATCGAGCTCGTGCCCGGTGTTGGTGAAATGACAAACATAAAGGTCTTATAGAGCACATTTTACATCAAGCATATGGCTGACTTTAATCTCCCACT ATGGCTCGTACGAAGCAAACTGCTCGCAAATCCACAGGTGGAAAGGCTCCCAGAAAGCAGCTTGCTACCAAGGCTGCGCGTAAGTCGGCACCCACTACTGGAGGCGTGAAGAAGCCACACAGATACCGCCCAGGAACAGTTGCTCTTCGAGAAATCCGCAAGTACCAGAAGAGTACTGAGCTTCTTATCCGCAAGCTCCCATTCCAGAGGCTTGTCCGAGAAATCGCACAAGATTTCAAGACAGATCTGCGTTTCCAGAGCCACGCGGTTTTGGCGTTGCAAGAGGCGGCTGAAGCTTACCTCGTTGGGCTGTTTGAAGATACCAATCTCTGCGCCATTCATGCCAAGCGTGTTACAATAATGCCGAAAGATATTCAACTTGCCAGAAGAATCCGTGGTGAAAGAGCTTAA MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Homology
BLAST of Cp4.1LG11g04490 vs. ExPASy Swiss-Prot
Match: P59169 (Histone H3.3 OS=Arabidopsis thaliana OX=3702 GN=HTR4 PE=1 SV=2) HSP 1 Score: 256.1 bits (653), Expect = 2.2e-67 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. ExPASy Swiss-Prot
Match: Q6RUR1 (Histone H3.3 OS=Capsicum annuum OX=4072 PE=2 SV=3) HSP 1 Score: 256.1 bits (653), Expect = 2.2e-67 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. ExPASy Swiss-Prot
Match: Q71V89 (Histone H3.3 OS=Gossypium hirsutum OX=3635 GN=HIS3 PE=2 SV=3) HSP 1 Score: 256.1 bits (653), Expect = 2.2e-67 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. ExPASy Swiss-Prot
Match: Q3C2E5 (Histone H3.3 OS=Lolium multiflorum OX=4521 GN=RH3 PE=2 SV=3) HSP 1 Score: 256.1 bits (653), Expect = 2.2e-67 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. ExPASy Swiss-Prot
Match: P69245 (Histone H3.3 OS=Lolium temulentum OX=34176 PE=2 SV=2) HSP 1 Score: 256.1 bits (653), Expect = 2.2e-67 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. NCBI nr
Match: WP_039311726.1 (MULTISPECIES: histone H3 [Bacteria] >NP_001031816.1 Histone superfamily protein [Arabidopsis thaliana] >NP_001078517.1 Histone superfamily protein [Arabidopsis thaliana] >NP_001131417.1 Histone H3.3 [Zea mays] >NP_001234218.1 histone H3 variant H3.3 [Solanum lycopersicum] >NP_001235785.1 uncharacterized LOC100305466 [Glycine max] >NP_001268032.1 histone H3.3 [Vitis vinifera] >NP_001295710.1 histone H3.3 [Jatropha curcas] >NP_001304168.1 Histone H3.3 [Zea mays] >NP_001311109.1 histone H3.3 [Zea mays] >NP_001328124.1 Histone superfamily protein [Arabidopsis thaliana] >NP_001329167.1 Histone superfamily protein [Arabidopsis thaliana] >NP_195713.1 Histone superfamily protein [Arabidopsis thaliana] >NP_196659.1 Histone superfamily protein [Arabidopsis thaliana] >NP_849529.1 Histone superfamily protein [Arabidopsis thaliana] >XP_002270349.1 PREDICTED: histone H3.3 [Vitis vinifera] >XP_002278809.1 PREDICTED: histone H3.3 [Vitis vinifera] >XP_002278833.1 PREDICTED: histone H3.3 [Vitis vinifera] >XP_002300726.1 histone H3.3 [Populus trichocarpa] >XP_002307702.1 histone H3.3 [Populus trichocarpa] >XP_002309961.1 histone H3.3 [Populus trichocarpa] >XP_002310848.1 histone H3.3 [Populus trichocarpa] >XP_002437756.1 histone H3.3 [Sorghum bicolor] >XP_002467760.1 histone H3.3 [Sorghum bicolor] >XP_002510489.1 histone H3.3 [Ricinus communis] >XP_002510490.1 histone H3.3 [Ricinus communis] >XP_002513959.1 histone H3.3 [Ricinus communis] >XP_002977792.1 histone H3.3 [Selaginella moellendorffii] >XP_002986910.1 histone H3.3 [Selaginella moellendorffii] >XP_003538608.1 histone H3.3 [Glycine max] >XP_003538611.1 histone H3.3 [Glycine max] >XP_003545047.1 histone H3.3 [Glycine max] >XP_003550410.1 histone H3.3 [Glycine max] >XP_003557131.1 histone H3.3 [Brachypodium distachyon] >XP_003557133.1 histone H3.3 [Brachypodium distachyon] >XP_003579868.1 histone H3.3 [Brachypodium distachyon] >XP_003589384.1 histone H3.3 [Medicago truncatula] >XP_003628560.1 histone H3.3 [Medicago truncatula] >XP_003635681.1 PREDICTED: histone H3.3 [Vitis vinifera] >XP_004146875.1 LOW QUALITY PROTEIN: histone H3.3 [Cucumis sativus] >XP_004152625.1 histone H3.3 [Cucumis sativus] >XP_004237940.1 histone H3.3 [Solanum lycopersicum] >XP_004238326.1 histone H3.3 [Solanum lycopersicum] >XP_004250115.1 histone H3.3 [Solanum lycopersicum] >XP_004287213.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] >XP_004288164.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] >XP_004288400.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] >XP_004299672.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] >XP_004499230.1 histone H3.3 [Cicer arietinum] >XP_004509059.1 histone H3.3 [Cicer arietinum] >XP_004952850.1 histone H3.3 [Setaria italica] >XP_004964429.1 histone H3.3 [Setaria italica] >XP_004975802.1 histone H3.3 [Setaria italica] >XP_004984150.1 histone H3.3 [Setaria italica] >XP_006284722.1 histone H3.3 [Capsella rubella] >XP_006284727.1 histone H3.3 [Capsella rubella] >XP_006288773.2 histone H3.3 [Capsella rubella] >XP_006302978.1 histone H3.3 [Capsella rubella] >XP_006342014.1 PREDICTED: histone H3.3 [Solanum tuberosum] >XP_006363289.1 PREDICTED: histone H3.3 [Solanum tuberosum] >XP_006366221.1 PREDICTED: histone H3.3 [Solanum tuberosum] >XP_006382893.1 histone H3.3 [Populus trichocarpa] >XP_006390289.1 histone H3.3 [Eutrema salsugineum] >XP_006399597.1 histone H3.3 [Eutrema salsugineum] >XP_006411806.2 histone H3.3 isoform X2 [Eutrema salsugineum] >XP_006426331.1 histone H3.3 [Citrus clementina] >XP_006435124.1 histone H3.3 [Citrus clementina] >XP_006466265.1 histone H3.3 [Citrus sinensis] >XP_006473607.1 histone H3.3 [Citrus sinensis] >XP_006591489.1 histone H3.3 [Glycine max] >XP_006650156.1 histone H3.3 [Oryza brachyantha] >XP_006652345.1 histone H3.3 [Oryza brachyantha] >XP_006655750.1 histone H3.3 [Oryza brachyantha] >XP_006827997.1 histone H3.3 [Amborella trichopoda] >XP_006838082.1 histone H3.3 [Amborella trichopoda] >XP_006849278.1 histone H3.3 [Amborella trichopoda] >XP_007047866.1 PREDICTED: histone H3.3 [Theobroma cacao] >XP_007160694.1 hypothetical protein PHAVU_001G009100g [Phaseolus vulgaris] >XP_007163667.1 hypothetical protein PHAVU_001G253700g [Phaseolus vulgaris] >XP_007207357.1 histone H3.3 [Prunus persica] >XP_007223801.1 histone H3.3 [Prunus persica] >XP_007226054.1 histone H3.3 [Prunus persica] >XP_008219337.1 PREDICTED: histone H3.3 [Prunus mume] >XP_008221310.1 PREDICTED: histone H3.3 [Prunus mume] >XP_008235104.1 PREDICTED: histone H3.3 [Prunus mume] >XP_008338566.1 histone H3.3 [Malus domestica] >XP_008343325.1 histone H3.3 [Malus domestica] >XP_008372995.1 histone H3.3 [Malus domestica] >XP_008386124.1 histone H3.3 [Malus domestica] >XP_008444859.1 PREDICTED: histone H3.3 [Cucumis melo] >XP_008453806.1 PREDICTED: histone H3.3 [Cucumis melo] >XP_008645853.1 histone H3.3 isoform X1 [Zea mays] >XP_008645854.1 histone H3.3 isoform X1 [Zea mays] >XP_008645855.1 histone H3.3 isoform X1 [Zea mays] >XP_008659340.1 histone H3.3 [Zea mays] >XP_008790920.1 histone H3.3 [Phoenix dactylifera] >XP_008790921.1 histone H3.3 [Phoenix dactylifera] >XP_008810061.1 histone H3.3 [Phoenix dactylifera] >XP_009104699.1 histone H3.3 [Brassica rapa] >XP_009125263.1 histone H3.3 [Brassica rapa] >XP_009130061.1 histone H3.3 [Brassica rapa] >XP_009131189.1 histone H3.3 [Brassica rapa] >XP_009339588.1 PREDICTED: histone H3.3 [Pyrus x bretschneideri] >XP_009348044.1 PREDICTED: histone H3.3 [Pyrus x bretschneideri] >XP_009365825.1 PREDICTED: histone H3.3 [Pyrus x bretschneideri] >XP_009373084.1 PREDICTED: histone H3.3 [Pyrus x bretschneideri] >XP_009383133.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] >XP_009391324.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] >XP_009391325.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] >XP_009417592.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] >XP_009418322.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] >XP_009589379.1 histone H3.3 [Nicotiana tomentosiformis] >XP_009622923.1 histone H3.3 [Nicotiana tomentosiformis] >XP_009623907.1 histone H3.3 [Nicotiana tomentosiformis] >XP_009771876.1 PREDICTED: histone H3.3 [Nicotiana sylvestris] >XP_009799309.1 PREDICTED: histone H3.3 [Nicotiana sylvestris] >XP_009799310.1 PREDICTED: histone H3.3 [Nicotiana sylvestris] >XP_010027928.1 histone H3.3 [Eucalyptus grandis] >XP_010061026.1 histone H3.3 [Eucalyptus grandis] >XP_010105254.1 histone H3.3 [Morus notabilis] >XP_010267031.1 PREDICTED: histone H3.3 [Nelumbo nucifera] >XP_010267040.1 PREDICTED: histone H3.3 [Nelumbo nucifera] >XP_010272988.1 PREDICTED: histone H3.3 [Nelumbo nucifera] >XP_010272989.1 PREDICTED: histone H3.3 [Nelumbo nucifera] >XP_010272990.1 PREDICTED: histone H3.3 [Nelumbo nucifera] >XP_010419651.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010431986.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010431987.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010431988.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010437129.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010453132.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010491788.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010526662.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010526992.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010533621.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010533639.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010536364.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010539857.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010539858.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010679856.1 PREDICTED: histone H3.3 [Beta vulgaris subsp. vulgaris] >XP_010681007.1 PREDICTED: histone H3.3 [Beta vulgaris subsp. vulgaris] >XP_010939695.1 histone H3.3 [Elaeis guineensis] >XP_010940939.1 histone H3.3 [Elaeis guineensis] >XP_011013190.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_011016807.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_011022826.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_011022827.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_011025928.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_011028962.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_011045138.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_011074645.1 histone H3.3 [Sesamum indicum] >XP_011097534.1 histone H3.3 [Sesamum indicum] >XP_011100034.1 histone H3.3 [Sesamum indicum] >XP_011459532.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] >XP_012065514.1 histone H3.3 [Jatropha curcas] >XP_012067913.1 histone H3.3 isoform X1 [Jatropha curcas] >XP_012071983.1 histone H3.3 [Jatropha curcas] >XP_012073854.1 histone H3.3 [Jatropha curcas] >XP_012445646.1 PREDICTED: histone H3.3 [Gossypium raimondii] >XP_012469821.1 PREDICTED: histone H3.3 [Gossypium raimondii] >XP_012469822.1 PREDICTED: histone H3.3 [Gossypium raimondii] >XP_012469823.1 PREDICTED: histone H3.3 [Gossypium raimondii] >XP_012469824.1 PREDICTED: histone H3.3 [Gossypium raimondii] >XP_012478125.1 PREDICTED: histone H3.3 [Gossypium raimondii] >XP_012568408.1 histone H3.3 [Cicer arietinum] >XP_012845140.1 PREDICTED: histone H3.3 [Erythranthe guttata] >XP_012845141.1 PREDICTED: histone H3.3 [Erythranthe guttata] >XP_012856050.1 PREDICTED: histone H3.3 [Erythranthe guttata] >XP_013457505.1 histone H3.3 [Medicago truncatula] >XP_013587978.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013587979.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013607869.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013607873.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013612488.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013612748.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013629194.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013648759.1 histone H3.3 [Brassica napus] >XP_013661886.1 histone H3.3 [Brassica napus] >XP_013678984.1 histone H3.3 [Brassica napus] >XP_013686983.1 histone H3.3 [Brassica napus] >XP_013693331.1 histone H3.3 [Brassica napus] >XP_013726329.1 histone H3.3 [Brassica napus] >XP_013729633.1 histone H3.3 [Brassica napus] >XP_013731924.1 histone H3.3 [Brassica napus] >XP_013736360.1 histone H3.3 [Brassica napus] >XP_014493712.1 histone H3.3 [Vigna radiata var. radiata] >XP_014493713.1 histone H3.3 [Vigna radiata var. radiata] >XP_014504575.1 histone H3.3 [Vigna radiata var. radiata] >XP_014619749.1 histone H3.3 [Glycine max] >XP_014619750.1 histone H3.3 [Glycine max] >XP_015058550.1 histone H3.3 [Solanum pennellii] >XP_015071832.1 histone H3.3 [Solanum pennellii] >XP_015076419.1 histone H3.3 [Solanum pennellii] >XP_015166737.1 PREDICTED: histone H3.3 [Solanum tuberosum] >XP_015571442.1 histone H3.3 [Ricinus communis] >XP_015630537.1 histone H3.3 [Oryza sativa Japonica Group] >XP_015643543.1 histone H3.3 [Oryza sativa Japonica Group] >XP_015884832.1 histone H3.3 [Ziziphus jujuba] >XP_015885275.1 histone H3.3 [Ziziphus jujuba] >XP_015885276.1 histone H3.3 [Ziziphus jujuba] >XP_015890774.1 histone H3.3 [Ziziphus jujuba] >XP_015933963.1 histone H3.3 [Arachis duranensis] >XP_015964233.1 histone H3.3 [Arachis duranensis] >XP_015964234.1 histone H3.3 [Arachis duranensis] >XP_015969656.1 histone H3.3 [Arachis duranensis] >XP_016167515.1 histone H3.3 [Arachis ipaensis] >XP_016201942.1 histone H3.3 [Arachis ipaensis] >XP_016201943.1 histone H3.3 [Arachis ipaensis] >XP_016204771.1 histone H3.3 [Arachis ipaensis] >XP_016473270.1 PREDICTED: histone H3.3 [Nicotiana tabacum] >XP_016480795.1 PREDICTED: histone H3.3 [Nicotiana tabacum] >XP_016480796.1 PREDICTED: histone H3.3 [Nicotiana tabacum] >XP_016490816.1 PREDICTED: histone H3.3 [Nicotiana tabacum] >XP_016493773.1 PREDICTED: histone H3.3 [Nicotiana tabacum] >XP_016499793.1 PREDICTED: histone H3.3 [Nicotiana tabacum] >XP_016550185.1 PREDICTED: histone H3.3 [Capsicum annuum] >XP_016550186.1 PREDICTED: histone H3.3 [Capsicum annuum] >XP_016568448.1 PREDICTED: histone H3.3 [Capsicum annuum] >XP_016569188.1 PREDICTED: histone H3.3 [Capsicum annuum] >XP_016573193.1 PREDICTED: histone H3.3 [Capsicum annuum] >XP_016687149.1 histone H3.3 [Gossypium hirsutum] >XP_016694168.1 histone H3.3 [Gossypium hirsutum] >XP_016740763.1 histone H3.3 [Gossypium hirsutum] >XP_016740764.1 histone H3.3 [Gossypium hirsutum] >XP_016740765.1 histone H3.3 [Gossypium hirsutum] >XP_016741524.1 histone H3.3 [Gossypium hirsutum] >XP_016742363.1 histone H3.3 [Gossypium hirsutum] >XP_016742364.2 histone H3.3 [Gossypium hirsutum] >XP_016748847.1 histone H3.3 [Gossypium hirsutum] >XP_017228549.1 PREDICTED: histone H3.3 [Daucus carota subsp. sativus] >XP_017230676.1 PREDICTED: histone H3.3 isoform X2 [Daucus carota subsp. sativus] >XP_017248172.1 PREDICTED: histone H3.3 [Daucus carota subsp. sativus] >XP_017418256.1 PREDICTED: histone H3.3 [Vigna angularis] >XP_017418257.1 PREDICTED: histone H3.3 [Vigna angularis] >XP_017430529.1 PREDICTED: histone H3.3 [Vigna angularis] >XP_017620403.1 PREDICTED: histone H3.3 [Gossypium arboreum] >XP_017623178.1 PREDICTED: histone H3.3 [Gossypium arboreum] >XP_017630755.1 PREDICTED: histone H3.3 [Gossypium arboreum] >XP_018442730.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018443026.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018447173.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018450392.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018468121.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018468122.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018474474.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018474475.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018511751.1 histone H3.3 [Brassica rapa] >XP_018623086.1 histone H3.3 [Nicotiana tomentosiformis] >XP_018821151.1 histone H3.3 [Juglans regia] >XP_018833909.1 histone H3.3 [Juglans regia] >XP_018847763.1 histone H3.3 [Juglans regia] >XP_018847764.1 histone H3.3 [Juglans regia] >XP_018849002.1 histone H3.3 [Juglans regia] >XP_019074729.1 PREDICTED: histone H3.3 [Vitis vinifera] >XP_019156140.1 PREDICTED: histone H3.3 [Ipomoea nil] >XP_019172343.1 PREDICTED: histone H3.3 [Ipomoea nil] >XP_019174535.1 PREDICTED: histone H3.3 [Ipomoea nil] >XP_019245391.1 PREDICTED: histone H3.3 [Nicotiana attenuata] >XP_019245392.1 PREDICTED: histone H3.3 [Nicotiana attenuata] >XP_019250044.1 PREDICTED: histone H3.3 [Nicotiana attenuata] >XP_019262398.1 PREDICTED: histone H3.3 [Nicotiana attenuata] >XP_019415255.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019416534.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019416535.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019422508.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019422509.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019437643.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019439992.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019702951.1 histone H3.3 [Elaeis guineensis] >XP_020083113.1 histone H3.3 [Ananas comosus] >XP_020094996.1 histone H3.3 [Ananas comosus] >XP_020101034.1 histone H3.3 [Ananas comosus] >XP_020101035.1 histone H3.3 [Ananas comosus] >XP_020158083.1 histone H3.3 [Aegilops tauschii subsp. strangulata] >XP_020158991.1 histone H3.3 [Aegilops tauschii subsp. strangulata] >XP_020169776.1 histone H3.3 [Aegilops tauschii subsp. strangulata] >XP_020174561.1 histone H3.3 [Aegilops tauschii subsp. strangulata] >XP_020186780.1 histone H3.3 [Aegilops tauschii subsp. strangulata] >XP_020187784.1 histone H3.3 [Aegilops tauschii subsp. strangulata] >XP_020210223.1 histone H3.3 [Cajanus cajan] >XP_020210235.1 histone H3.3 [Cajanus cajan] >XP_020235796.1 histone H3.3 [Cajanus cajan] >XP_020255783.1 histone H3.3 [Asparagus officinalis] >XP_020393141.1 histone H3.3 isoform X1 [Zea mays] >XP_020571918.1 histone H3.3 [Phalaenopsis equestris] >XP_020575443.1 histone H3.3 [Phalaenopsis equestris] >XP_020582702.1 histone H3.3 [Phalaenopsis equestris] >XP_020582703.1 histone H3.3 [Phalaenopsis equestris] >XP_020582704.1 histone H3.3 [Phalaenopsis equestris] >XP_020672589.1 histone H3.3 [Dendrobium catenatum] >XP_020691527.1 histone H3.3 [Dendrobium catenatum] >XP_020706026.1 histone H3.3 [Dendrobium catenatum] >XP_020875248.1 histone H3.3 [Arabidopsis lyrata subsp. lyrata] >XP_020875249.1 histone H3.3 [Arabidopsis lyrata subsp. lyrata] >XP_020875250.1 histone H3.3 [Arabidopsis lyrata subsp. lyrata] >XP_020875251.1 histone H3.3 [Arabidopsis lyrata subsp. lyrata] >XP_020876760.1 histone H3.3 [Arabidopsis lyrata subsp. lyrata] >XP_021300852.1 histone H3.3 [Herrania umbratica] >XP_021318678.1 histone H3.3 [Sorghum bicolor] >XP_021601595.1 histone H3.3 [Manihot esculenta] >XP_021604130.1 histone H3.3 [Manihot esculenta] >XP_021604131.1 histone H3.3 [Manihot esculenta] >XP_021642193.1 histone H3.3 [Hevea brasiliensis] >XP_021642194.1 histone H3.3 [Hevea brasiliensis] >XP_021642195.1 histone H3.3 [Hevea brasiliensis] >XP_021677683.1 histone H3.3 [Hevea brasiliensis] >XP_021682227.1 histone H3.3 [Hevea brasiliensis] >XP_021682235.1 histone H3.3 [Hevea brasiliensis] >XP_021682246.1 histone H3.3 [Hevea brasiliensis] >XP_021683971.1 histone H3.3 [Hevea brasiliensis] >XP_021683972.1 histone H3.3 [Hevea brasiliensis] >XP_021683973.1 histone H3.3 [Hevea brasiliensis] >XP_021692618.1 histone H3.3 [Hevea brasiliensis] >XP_021692619.1 histone H3.3 [Hevea brasiliensis] >XP_021692620.1 histone H3.3 [Hevea brasiliensis] >XP_021725434.1 histone H3.3 [Chenopodium quinoa] >XP_021743808.1 histone H3.3 [Chenopodium quinoa] >XP_021758536.1 histone H3.3 [Chenopodium quinoa] >XP_021759838.1 histone H3.3 [Chenopodium quinoa] >XP_021808227.1 histone H3.3 [Prunus avium] >XP_021816370.1 histone H3.3 [Prunus avium] >XP_021831044.1 histone H3.3 [Prunus avium] >XP_021852320.1 histone H3.3 [Spinacia oleracea] >XP_021897582.1 histone H3.3 isoform X2 [Carica papaya] >XP_021900656.1 histone H3.3 [Carica papaya] >XP_021983725.1 histone H3.3 [Helianthus annuus] >XP_021987122.1 histone H3.3 [Helianthus annuus] >XP_022012437.1 histone H3.3 [Helianthus annuus] >XP_022016556.1 histone H3.3 [Helianthus annuus] >XP_022018613.1 histone H3.3 [Helianthus annuus] >XP_022034460.1 histone H3.3 [Helianthus annuus] >XP_022039836.1 histone H3.3 [Helianthus annuus] >XP_022131890.1 histone H3.3 [Momordica charantia] >XP_022136592.1 histone H3.3 [Momordica charantia] >XP_022554285.1 histone H3.3 [Brassica napus] >XP_022554306.1 histone H3.3 [Brassica napus] >XP_022739923.1 histone H3.3 [Durio zibethinus] >XP_022751107.1 histone H3.3 [Durio zibethinus] >XP_022759088.1 histone H3.3 [Durio zibethinus] >XP_022768369.1 histone H3.3 [Durio zibethinus] >XP_022769125.1 histone H3.3 [Durio zibethinus] >XP_022773129.1 histone H3.3 [Durio zibethinus] >XP_022773130.1 histone H3.3 [Durio zibethinus] >XP_022775006.1 histone H3.3 [Durio zibethinus] >XP_022844252.1 histone H3.3 [Olea europaea var. sylvestris] >XP_022879547.1 histone H3.3 [Olea europaea var. sylvestris] >XP_022894730.1 histone H3.3 [Olea europaea var. sylvestris] >XP_022894731.1 histone H3.3 [Olea europaea var. sylvestris] >XP_022929483.1 histone H3.3 [Cucurbita moschata] >XP_022929484.1 histone H3.3 [Cucurbita moschata] >XP_022942250.1 histone H3.3 [Cucurbita moschata] >XP_022951615.1 histone H3.3 isoform X3 [Cucurbita moschata] >XP_022962486.1 histone H3.3 [Cucurbita moschata] >XP_022962487.1 histone H3.3 [Cucurbita moschata] >XP_022983298.1 histone H3.3 [Cucurbita maxima] >XP_022985522.1 histone H3.3 [Cucurbita maxima] >XP_022985523.1 histone H3.3 [Cucurbita maxima] >XP_022997288.1 histone H3.3 isoform X2 [Cucurbita maxima] >XP_022997289.1 histone H3.3 isoform X2 [Cucurbita maxima] >XP_023002731.1 histone H3.3 isoform X2 [Cucurbita maxima] >XP_023002732.1 histone H3.3 isoform X2 [Cucurbita maxima] >XP_023531730.1 histone H3.3 [Cucurbita pepo subsp. pepo] >XP_023537222.1 histone H3.3 isoform X2 [Cucurbita pepo subsp. pepo] >XP_023547031.1 histone H3.3 [Cucurbita pepo subsp. pepo] >XP_023553020.1 histone H3.3 [Cucurbita pepo subsp. pepo] >XP_023553021.1 histone H3.3 [Cucurbita pepo subsp. pepo] >XP_023738568.1 histone H3.3 [Lactuca sativa] >XP_023762347.1 histone H3.3 [Lactuca sativa] >XP_023767145.1 histone H3.3 [Lactuca sativa] >XP_023769112.1 histone H3.3 [Lactuca sativa] >XP_023884417.1 histone H3.3 [Quercus suber] >XP_023885343.1 histone H3.3 [Quercus suber] >XP_023924801.1 histone H3.3 [Quercus suber] >XP_024005719.1 histone H3.3 isoform X2 [Eutrema salsugineum] >XP_024005720.1 histone H3.3 [Eutrema salsugineum] >XP_024005721.1 histone H3.3 [Eutrema salsugineum] >XP_024027945.1 histone H3.3 [Morus notabilis] >XP_024162518.1 histone H3.3 [Rosa chinensis] >XP_024162520.1 histone H3.3 [Rosa chinensis] >XP_024173826.1 histone H3.3 [Rosa chinensis] >XP_024185980.1 histone H3.3 [Rosa chinensis] >XP_024188068.1 histone H3.3 [Rosa chinensis] >XP_024401741.1 histone H3.3 isoform X2 [Physcomitrium patens] >XP_024402425.1 histone H3.3 [Physcomitrium patens] >XP_024402426.1 histone H3.3 [Physcomitrium patens] >XP_024403257.1 histone H3.3 [Physcomitrium patens] >XP_024403258.1 histone H3.3 [Physcomitrium patens] >XP_024403259.1 histone H3.3 [Physcomitrium patens] >XP_024403260.1 histone H3.3 [Physcomitrium patens] >XP_024451503.1 histone H3.3 [Populus trichocarpa] >XP_024457821.1 histone H3.3 [Populus trichocarpa] >XP_024637698.2 histone H3.3 [Medicago truncatula] >XP_024963143.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024963144.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024969177.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024969912.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024969913.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024971883.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024976044.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024976045.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_025015280.1 histone H3.3 [Ricinus communis] >XP_025604872.1 histone H3.3 [Arachis hypogaea] >XP_025612284.1 histone H3.3 [Arachis hypogaea] >XP_025653569.1 histone H3.3 [Arachis hypogaea] >XP_025653570.1 histone H3.3 [Arachis hypogaea] >XP_025657733.1 histone H3.3 [Arachis hypogaea] >XP_025665795.1 histone H3.3 [Arachis hypogaea] >XP_025698977.1 histone H3.3 [Arachis hypogaea] >XP_025797925.1 histone H3.3 [Panicum hallii] >XP_025811526.1 histone H3.3 [Panicum hallii] >XP_026391126.1 histone H3.3 [Papaver somniferum] >XP_026393705.1 histone H3.3 [Papaver somniferum] >XP_026394875.1 histone H3.3 [Papaver somniferum] >XP_026412817.1 histone H3.3 [Papaver somniferum] >XP_026416476.1 histone H3.3 [Papaver somniferum] >XP_026434177.1 histone H3.3 [Papaver somniferum] >XP_026447014.1 histone H3.3 [Papaver somniferum] >XP_027073143.1 histone H3.3 [Coffea arabica] >XP_027073144.1 histone H3.3 [Coffea arabica] >XP_027074928.1 histone H3.3 isoform X2 [Coffea arabica] >XP_027076594.1 histone H3.3 [Coffea arabica] >XP_027076595.1 histone H3.3 [Coffea arabica] >XP_027078385.1 histone H3.3 [Coffea arabica] >XP_027092332.1 histone H3.3 [Coffea arabica] >XP_027095050.1 histone H3.3 [Coffea arabica] >XP_027148944.1 histone H3.3 [Coffea eugenioides] >XP_027178611.1 histone H3.3 [Coffea eugenioides] >XP_027178612.1 histone H3.3 [Coffea eugenioides] >XP_027179615.1 histone H3.3 [Coffea eugenioides] >XP_027330522.1 histone H3.3 [Abrus precatorius] >XP_027330523.1 histone H3.3 [Abrus precatorius] >XP_027330524.1 histone H3.3 [Abrus precatorius] >XP_027336110.1 histone H3.3 isoform X2 [Abrus precatorius] >XP_027336112.1 histone H3.3 [Abrus precatorius] >XP_027930371.1 histone H3.3 [Vigna unguiculata] >XP_027940907.1 histone H3.3 [Vigna unguiculata] >XP_028068058.1 histone H3.3 [Camellia sinensis] >XP_028068059.1 histone H3.3 [Camellia sinensis] >XP_028082913.1 histone H3.3 [Camellia sinensis] >XP_028082914.1 histone H3.3 [Camellia sinensis] >XP_028098056.1 histone H3.3 [Camellia sinensis] >XP_028098057.1 histone H3.3 [Camellia sinensis] >XP_028103173.1 histone H3.3 [Camellia sinensis] >XP_028197790.1 histone H3.3 [Glycine soja] >XP_028197791.1 histone H3.3 [Glycine soja] >XP_028199797.1 histone H3.3 [Glycine soja] >XP_028211274.1 histone H3.3 [Glycine soja] >XP_028214429.1 histone H3.3 [Glycine soja] >XP_028752343.1 histone H3.3 [Prosopis alba] >XP_028752345.1 histone H3.3 [Prosopis alba] >XP_028774553.1 histone H3.3 [Prosopis alba] >XP_028774554.1 histone H3.3 [Prosopis alba] >XP_028807152.1 histone H3.3 [Prosopis alba] >XP_028807153.1 histone H3.3 [Prosopis alba] >XP_030444786.1 histone H3.3 [Syzygium oleosum] >XP_030446233.1 histone H3.3 [Syzygium oleosum] >XP_030446239.1 histone H3.3 [Syzygium oleosum] >XP_030497172.1 histone H3.3 [Cannabis sativa] >XP_030527272.1 histone H3.3 [Rhodamnia argentea] >XP_030528250.1 histone H3.3 [Rhodamnia argentea] >XP_030950682.1 histone H3.3 [Quercus lobata] >XP_030973758.1 histone H3.3 [Quercus lobata] >XP_030975518.1 histone H3.3 [Quercus lobata] >XP_031090686.1 histone H3.3 [Ipomoea triloba] >XP_031107430.1 histone H3.3 [Ipomoea triloba] >XP_031124949.1 histone H3.3 [Ipomoea triloba] >XP_031282248.1 histone H3.3 [Pistacia vera] >XP_031282249.1 histone H3.3 [Pistacia vera] >XP_031287254.1 histone H3.3 [Pistacia vera] >XP_031388551.1 histone H3.3 [Punica granatum] >XP_031396261.1 histone H3.3 [Punica granatum] >XP_031406478.1 histone H3.3 [Punica granatum] >XP_031476909.1 histone H3.3 [Nymphaea colorata] >XP_031476910.1 histone H3.3 [Nymphaea colorata] >XP_031498900.1 histone H3.3 [Nymphaea colorata] >XP_031745660.1 LOW QUALITY PROTEIN: histone H3.3-like [Cucumis sativus] >XP_031745661.1 LOW QUALITY PROTEIN: histone H3.3-like [Cucumis sativus] >XP_031745707.1 histone H3.3 [Cucumis sativus] >XP_034200565.1 histone H3.3 [Prunus dulcis] >XP_034200566.1 histone H3.3 [Prunus dulcis] >XP_034201534.1 histone H3.3 [Prunus dulcis] >XP_034220045.1 histone H3.3 [Prunus dulcis] >XP_034576866.1 histone H3.3 [Setaria viridis] >XP_034592202.1 histone H3.3 [Setaria viridis] >XP_034605389.1 histone H3.3 [Setaria viridis] >XP_034606178.1 histone H3.3 [Setaria viridis] >XP_034675846.1 histone H3.3 [Vitis riparia] >XP_034684581.1 histone H3.3 [Vitis riparia] >XP_034691694.1 histone H3.3 [Vitis riparia] >XP_034891485.1 histone H3.3 [Populus alba] >XP_034891965.1 histone H3.3 [Populus alba] >XP_034907303.1 histone H3.3 [Populus alba] >XP_034919665.1 histone H3.3 [Populus alba] >XP_034931639.1 histone H3.3 [Populus alba] >XP_034932962.1 histone H3.3 [Populus alba] >XP_034932963.1 histone H3.3 [Populus alba] >XP_034932964.1 histone H3.3 [Populus alba] >XP_035547814.1 histone H3.3 [Juglans regia] >XP_037423474.1 histone H3.3 [Triticum dicoccoides] >XP_037423476.1 histone H3.3 [Triticum dicoccoides] >XP_037423500.1 histone H3.3 [Triticum dicoccoides] >XP_037457257.1 histone H3.3 [Triticum dicoccoides] >XP_037459167.1 histone H3.3 [Triticum dicoccoides] >XP_037459261.1 histone H3.3 [Triticum dicoccoides] >XP_037465375.1 histone H3.3 [Triticum dicoccoides] >XP_037466998.1 histone H3.3 [Triticum dicoccoides] >XP_037468735.1 histone H3.3 [Triticum dicoccoides] >XP_037477997.1 histone H3.3 [Triticum dicoccoides] >XP_037485821.1 histone H3.3 [Triticum dicoccoides] >XP_038693909.1 histone H3.3 [Tripterygium wilfordii] >XP_038693917.1 histone H3.3 [Tripterygium wilfordii] >XP_038701783.1 histone H3.3 [Tripterygium wilfordii] >XP_038716525.1 histone H3.3 [Tripterygium wilfordii] >XP_038716526.1 histone H3.3 [Tripterygium wilfordii] >XP_038716527.1 histone H3.3 [Tripterygium wilfordii] >XP_038718508.1 histone H3.3 [Tripterygium wilfordii] >XP_038720864.1 histone H3.3 [Tripterygium wilfordii] >XP_038722383.1 histone H3.3 [Tripterygium wilfordii] >XP_038877463.1 histone H3.3 isoform X2 [Benincasa hispida] >XP_038877467.1 histone H3.3 isoform X2 [Benincasa hispida] >XP_038886002.1 histone H3.3 [Benincasa hispida] >XP_039012583.1 histone H3.3 [Hibiscus syriacus] >XP_039041514.1 histone H3.3 [Hibiscus syriacus] >XP_039041515.1 histone H3.3 [Hibiscus syriacus] >XP_039056155.1 histone H3.3 [Hibiscus syriacus] >XP_039064249.1 histone H3.3 [Hibiscus syriacus] >XP_039064293.1 histone H3.3 [Hibiscus syriacus] >XP_039065652.1 histone H3.3 [Hibiscus syriacus] >XP_039065653.1 histone H3.3 [Hibiscus syriacus] >XP_039069794.1 histone H3.3 [Hibiscus syriacus] >XP_039127075.1 histone H3.3 [Dioscorea cayenensis subsp. rotundata] >XP_039127395.1 histone H3.3 [Dioscorea cayenensis subsp. rotundata] >XP_039135304.1 histone H3.3 [Dioscorea cayenensis subsp. rotundata] >XP_039785839.1 histone H3.3 [Panicum virgatum] >XP_039832728.1 histone H3.3 [Panicum virgatum] >XP_039842235.1 histone H3.3 [Panicum virgatum] >XP_040937939.1 histone H3.3 [Gossypium hirsutum] >XP_040937941.1 histone H3.3 [Gossypium hirsutum] >XP_040937944.1 histone H3.3 [Gossypium hirsutum] >XP_040945596.1 histone H3.3 [Gossypium hirsutum] >XP_040997540.1 histone H3.3 [Juglans microcarpa x Juglans regia] >XP_041005240.1 histone H3.3 [Juglans microcarpa x Juglans regia] >XP_041005241.1 histone H3.3 [Juglans microcarpa x Juglans regia] >XP_041005242.1 histone H3.3 [Juglans microcarpa x Juglans regia] >XP_041005243.1 histone H3.3 [Juglans microcarpa x Juglans regia] >XP_041005244.1 histone H3.3 [Juglans microcarpa x Juglans regia] >XP_041005245.1 histone H3.3 [Juglans microcarpa x Juglans regia] >XP_041008772.1 histone H3.3 isoform X2 [Juglans microcarpa x Juglans regia] >XP_041008773.1 histone H3.3 isoform X2 [Juglans microcarpa x Juglans regia] >XP_041020023.1 histone H3.3 [Juglans microcarpa x Juglans regia] >XP_042004914.1 histone H3.3 [Salvia splendens] >XP_042008405.1 histone H3.3 [Salvia splendens] >XP_042013890.1 histone H3.3 [Salvia splendens] >XP_042016879.1 histone H3.3 [Salvia splendens] >XP_042016880.1 histone H3.3 [Salvia splendens] >XP_042021950.1 histone H3.3 [Salvia splendens] >XP_042024309.1 histone H3.3 [Salvia splendens] >XP_042388699.1 histone H3.3 [Zingiber officinale] >XP_042393450.1 histone H3.3 [Zingiber officinale] >XP_042442191.1 histone H3.3 [Zingiber officinale] >XP_042443231.1 histone H3.3 [Zingiber officinale] >XP_042443417.1 histone H3.3 [Zingiber officinale] >XP_042443419.1 histone H3.3 [Zingiber officinale] >XP_042447679.1 histone H3.3 [Zingiber officinale] >XP_042450175.1 histone H3.3 [Zingiber officinale] >XP_042468447.1 histone H3.3 [Zingiber officinale] >XP_042473188.1 histone H3.3 [Zingiber officinale] >XP_042478449.1 histone H3.3 [Macadamia integrifolia] >XP_042481316.1 histone H3.3 [Macadamia integrifolia] >XP_042494071.1 histone H3.3 [Macadamia integrifolia] >XP_042509022.1 histone H3.3 [Macadamia integrifolia] >XP_042960320.1 histone H3.3 [Carya illinoinensis] >XP_042960321.1 histone H3.3 [Carya illinoinensis] >XP_042971461.1 histone H3.3 [Carya illinoinensis] >XP_042975969.1 histone H3.3 [Carya illinoinensis] >XP_042975970.1 histone H3.3 [Carya illinoinensis] >XP_042989331.1 histone H3.3 [Carya illinoinensis] >A2XHJ3.1 RecName: Full=Histone H3.3; AltName: Full=H3.2 [Oryza sativa Indica Group] >P59169.2 RecName: Full=Histone H3.3; AltName: Full=Histone H3.2 [Arabidopsis thaliana] >P69244.2 RecName: Full=Histone H3.3; AltName: Full=Histone H3.2; AltName: Full=Minor histone H3 [Medicago sativa] >P69245.2 RecName: Full=Histone H3.3 [Lolium temulentum] >P80553.3 RecName: Full=Histone H3 [Narcissus pseudonarcissus] >Q0JCT1.2 RecName: Full=Histone H3.3; AltName: Full=H3.2 [Oryza sativa Japonica Group] >Q3C2E5.3 RecName: Full=Histone H3.3; AltName: Full=Replacement histone H3 [Lolium multiflorum] >Q6RUR1.3 RecName: Full=Histone H3.3 [Capsicum annuum] >Q711T2.3 RecName: Full=Histone H3.3 [Pinus pinaster] >Q71H73.3 RecName: Full=Histone H3.3 [Vitis vinifera] >Q71U98.3 RecName: Full=Histone H3.3 [Oryza coarctata] >Q71V89.3 RecName: Full=Histone H3.3 [Gossypium hirsutum] >Q76N23.1 RecName: Full=Histone H3.3 [Nicotiana tabacum] >AAX92697.1 histone 3 [Picea abies] >AAZ72655.1 histone H3.1 [Craterostigma plantagineum] >ABI97039.1 histone H3 [Robinia pseudoacacia] >ABK21404.1 unknown [Picea sitchensis] >ABK96416.1 unknown [Populus trichocarpa x Populus deltoides] >ABP04114.1 histone 3 [Lemna minor] >ACN65412.1 histone 3.2 [Pteris vittata] >ADI87404.1 histone H3 [Oryza sativa] >ADV77197.1 histone H3, partial [Cladophora coelothrix] >AEZ52395.1 histone H3 [Wolffia australiana] >AFC88829.1 histone H23-like protein, partial [Miscanthus sinensis] >AFK33416.1 unknown [Lotus japonicus] >AFM30053.1 histone H3 [Chimonanthus praecox] >AFP44115.1 histone H3 [Lycoris longituba] >AFZ93649.1 histone H3 [Euphorbia lathyris] >AGN12774.1 histone H3 [Leavenworthia alabamica] >AGT16456.1 histone H3 [Saccharum hybrid cultivar R570] >AHZ58484.1 histone H3 [Syntrichia caninervis] >AKR53658.1 histone H3 [Oxytropis ochrocephala] >ANS54494.1 histone H3 [Brassica rapa subsp. chinensis] >AQA28697.1 histone 3 [Hibiscus cannabinus] >AXU39911.1 histone H3, partial [Narcissus papyraceus] >EPS60563.1 hypothetical protein M569_14240 [Genlisea aurea] >KAA0044715.1 histone H3.3 isoform X1 [Cucumis melo var. makuwa] >KAA3457368.1 histone H3.3 isoform X1 [Gossypium australe] >KAA8528716.1 hypothetical protein F0562_036071 [Nyssa sinensis] >KAB1201870.1 histone H3.3 [Morella rubra] >KAB2030497.1 hypothetical protein ES319_D05G236100v1 [Gossypium barbadense] >KAB2597469.1 hypothetical protein D8674_000389 [Pyrus ussuriensis x Pyrus communis] >KAE8099944.1 hypothetical protein FH972_017887 [Carpinus fangiana] >KAE8769350.1 histone H3.3 [Hordeum vulgare] >KAE9456976.1 hypothetical protein C3L33_11119, partial [Rhododendron williamsianum] >KAE9603544.1 putative transcription factor Hap3/NF-YB family [Lupinus albus] >KAF0890320.1 hypothetical protein E2562_002730 [Oryza meyeriana var. granulata] >KAF2596359.1 hypothetical protein F2Q68_00009115 [Brassica cretica] >KAF3325068.1 histone H3.3 [Carex littledalei] >KAF3439249.1 hypothetical protein FNV43_RR17525 [Rhamnella rubrinervis] >KAF3968962.1 hypothetical protein CMV_007197 [Castanea mollissima] >KAF6170305.1 hypothetical protein GIB67_042995 [Kingdonia uniflora] >KAF7002023.1 hypothetical protein CFC21_017565 [Triticum aestivum] >KAF7113222.1 hypothetical protein RHSIM_RhsimUnG0148600 [Rhododendron simsii] >KAF7809674.1 histone H3.3 [Senna tora] >KAF8012250.1 hypothetical protein BT93_I0396 [Corymbia citriodora subsp. variegata] >KAF8075574.1 hypothetical protein N665_1080s0012 [Sinapis alba] >KAF8377330.1 hypothetical protein HHK36_030707 [Tetracentron sinense] >KAF8653072.1 hypothetical protein HU200_062513 [Digitaria exilis] >KAF9616163.1 hypothetical protein IFM89_028629 [Coptis chinensis] >KAF9683111.1 hypothetical protein SADUNF_Sadunf05G0178200 [Salix dunnii] >KAF9861997.1 hypothetical protein H0E87_013012 [Populus deltoides] >KAG0451614.1 hypothetical protein HPP92_026132 [Vanilla planifolia] >KAG0564264.1 hypothetical protein KC19_8G096900 [Ceratodon purpureus] >KAG1359159.1 histone H3.3 [Cocos nucifera] >KAG2239507.1 hypothetical protein Bca52824_091652 [Brassica carinata] >KAG5241124.1 histone [Salix suchowensis] >KAG5403038.1 hypothetical protein IGI04_009157 [Brassica rapa subsp. trilocularis] >KAG5543086.1 hypothetical protein RHGRI_015986 [Rhododendron griersonianum] >KAG5574603.1 hypothetical protein H5410_054737 [Solanum commersonii] >KAG6542595.1 hypothetical protein Mapa_016066 [Marchantia paleacea] >KAG6767351.1 hypothetical protein POTOM_028551 [Populus tomentosa] >KAG7015373.1 hypothetical protein SDJN02_23008, partial [Cucurbita argyrosperma subsp. argyrosperma] >KAG7539940.1 Histone-fold [Arabidopsis thaliana x Arabidopsis arenosa] >KAG7544631.1 Histone H2A/H2B/H3 [Arabidopsis suecica] >KAG8094023.1 hypothetical protein GUJ93_ZPchr0012g20647 [Zizania palustris] >KAG8373403.1 hypothetical protein BUALT_Bualt11G0020700 [Buddleja alternifolia] >KAG8499096.1 hypothetical protein CXB51_005511 [Gossypium anomalum] >KAG9129691.1 hypothetical protein Leryth_017764 [Lithospermum erythrorhizon] >KAG9443088.1 hypothetical protein H6P81_018942 [Aristolochia fimbriata] >KFK32443.1 hypothetical protein AALP_AA6G242400 [Arabis alpina] >KMZ66600.1 histone H3 [Zostera marina] >KRX12280.1 histone H3.3 [Trichinella nelsoni] >KZV30103.1 hypothetical protein F511_19646 [Dorcoceras hygrometricum] >MBA0575507.1 hypothetical protein [Gossypium lobatum] >MBA0669836.1 hypothetical protein [Gossypium klotzschianum] >MBA0681957.1 hypothetical protein [Gossypium aridum] >MBA0707173.1 hypothetical protein [Gossypium laxum] >MBA0735093.1 hypothetical protein [Gossypium gossypioides] >MBA0761034.1 hypothetical protein [Gossypium trilobum] >MBA0798116.1 hypothetical protein [Gossypium harknessii] >MBA0845775.1 hypothetical protein [Gossypium armourianum] >MBA0851864.1 hypothetical protein [Gossypium schwendimanii] >MBC9830370.1 hypothetical protein [Adiantum capillus-veneris] >OAE23194.1 hypothetical protein AXG93_1630s1090 [Marchantia polymorpha subsp. ruderalis] >OMO56148.1 histone H3 [Corchorus capsularis] >OMO75311.1 histone H3 [Corchorus olitorius] >PHT31283.1 histone H3.3 [Capsicum baccatum] >PHU00022.1 histone H3.3 [Capsicum chinense] >PIA36108.1 hypothetical protein AQUCO_03400189v1 [Aquilegia coerulea] >PIM98299.1 Histones H3 and H4 [Handroanthus impetiginosus] >PKA47676.1 Histone H3.3 [Apostasia shenzhenica] >PSR99862.1 histone H3.3 [Actinidia chinensis var. chinensis] >PTQ31889.1 hypothetical protein MARPO_0105s0008 [Marchantia polymorpha] >PUZ62376.1 hypothetical protein GQ55_4G352300 [Panicum hallii var. hallii] >PWA59407.1 histone H3.3 [Artemisia annua] >QAU32328.1 histone H3.3 [Brassica oleracea var. botrytis] >QBK96584.1 histone H3.3 isoform X1 [Huperzia serrata] >QIC19047.1 histone H3 [Adiantum reniforme var. sinense] >QOU08745.1 histone, partial [Larix gmelinii var. olgensis] >RAL52990.1 hypothetical protein DM860_016225 [Cuscuta australis] >RRT50070.1 hypothetical protein B296_00028354 [Ensete ventricosum] >RWR79177.1 Histone superfamily protein [Cinnamomum micranthum f. kanehirae] >TKY47675.1 histone H3.3 [Spatholobus suberectus] >TMW82145.1 hypothetical protein EJD97_006661 [Solanum chilense] >TQE14174.1 hypothetical protein C1H46_000093 [Malus baccata] >TVU46775.1 hypothetical protein EJB05_06334 [Eragrostis curvula] >TXG52120.1 hypothetical protein EZV62_021289 [Acer yangbiense] >TYG69649.1 hypothetical protein ES288_D05G247400v1 [Gossypium darwinii] >TYH72315.1 hypothetical protein ES332_D05G246300v1 [Gossypium tomentosum] >TYI82716.1 hypothetical protein E1A91_D05G240300v1 [Gossypium mustelinum] >CAA2619127.1 unnamed protein product [Spirodela intermedia] >CAA2937347.1 histone [Olea europaea subsp. europaea] >CAA7020519.1 unnamed protein product [Microthlaspi erraticum] >CAB4078805.1 unnamed protein product [Lactuca saligna] >CAB4265613.1 unnamed protein product [Prunus armeniaca] >CAD1826324.1 unnamed protein product [Ananas comosus var. bracteatus] >CAE6095410.1 unnamed protein product [Arabidopsis arenosa] >CAJ38369.1 histin H3 [Plantago major] >CDP01510.1 unnamed protein product [Coffea canephora] >CUT18456.1 H3.3 [Lilium davidii var. unicolor] >VAH32911.1 unnamed protein product [Triticum turgidum subsp. durum] >VDC85868.1 unnamed protein product [Brassica oleracea] >VFQ63220.1 unnamed protein product [Cuscuta campestris] >VVA95374.1 unnamed protein product [Arabis nemorensis] >BAJ86347.1 predicted protein [Hordeum vulgare subsp. vulgare] >BAL04972.1 histone H3 [Zoysia japonica] >BAS30508.1 histone H3-1 [Pyramimonas parkeae] >BAT82801.1 hypothetical protein VIGAN_03286800 [Vigna angularis var. angularis] >GAU41101.1 hypothetical protein TSUD_139700 [Trifolium subterraneum] >GAV79343.1 Histone domain-containing protein, partial [Cephalotus follicularis] >GAY38739.1 hypothetical protein CUMW_038970 [Citrus unshiu] >GBG71910.1 hypothetical protein CBR_g10846 [Chara braunii] >GER26173.1 histone H3 [Striga asiatica] >GEW22143.1 histone H3.3 [Tanacetum cinerariifolium] >GFP82408.1 histone h3.3 [Phtheirospermum japonicum] >GFY94055.1 histone superfamily protein [Actinidia rufa]) HSP 1 Score: 257 bits (656), Expect = 5.45e-86 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. NCBI nr
Match: PRQ48589.1 (putative transcription factor Hap3/NF-YB family [Rosa chinensis] >CAN70652.1 hypothetical protein VITISV_010022 [Vitis vinifera]) HSP 1 Score: 257 bits (656), Expect = 5.64e-86 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. NCBI nr
Match: TJW23211.1 (histone H3 [Bacillus paralicheniformis]) HSP 1 Score: 257 bits (656), Expect = 5.83e-86 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. NCBI nr
Match: VAI83787.1 (unnamed protein product [Triticum turgidum subsp. durum]) HSP 1 Score: 257 bits (656), Expect = 5.83e-86 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. NCBI nr
Match: RLN18442.1 (histone H3.3 [Panicum miliaceum]) HSP 1 Score: 257 bits (656), Expect = 5.83e-86 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. ExPASy TrEMBL
Match: A0A0V0RDG7 (Histone H3 OS=Trichinella nelsoni OX=6336 GN=T07_6184 PE=3 SV=1) HSP 1 Score: 257 bits (656), Expect = 2.64e-86 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. ExPASy TrEMBL
Match: A0A5D2HEA1 (Histone H3 OS=Gossypium darwinii OX=34276 GN=ES288_A02G110500v1 PE=3 SV=1) HSP 1 Score: 257 bits (656), Expect = 2.64e-86 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. ExPASy TrEMBL
Match: Q6LB28 (Histone H3 OS=Solanum lycopersicum OX=4081 GN=101263309 PE=2 SV=1) HSP 1 Score: 257 bits (656), Expect = 2.64e-86 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. ExPASy TrEMBL
Match: A0A6J1J540 (Histone H3 OS=Cucurbita maxima OX=3661 GN=LOC111483511 PE=3 SV=1) HSP 1 Score: 257 bits (656), Expect = 2.64e-86 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. ExPASy TrEMBL
Match: A0A087GRE1 (Histone H3 OS=Arabis alpina OX=50452 GN=AALP_AA2G198300 PE=3 SV=1) HSP 1 Score: 257 bits (656), Expect = 2.64e-86 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. TAIR 10
Match: AT4G40030.1 (Histone superfamily protein ) HSP 1 Score: 256.1 bits (653), Expect = 1.5e-68 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. TAIR 10
Match: AT4G40040.1 (Histone superfamily protein ) HSP 1 Score: 256.1 bits (653), Expect = 1.5e-68 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. TAIR 10
Match: AT4G40040.2 (Histone superfamily protein ) HSP 1 Score: 256.1 bits (653), Expect = 1.5e-68 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. TAIR 10
Match: AT4G40030.2 (Histone superfamily protein ) HSP 1 Score: 256.1 bits (653), Expect = 1.5e-68 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g04490 vs. TAIR 10
Match: AT4G40030.3 (Histone superfamily protein ) HSP 1 Score: 256.1 bits (653), Expect = 1.5e-68 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|