Cp4.1LG06g07940 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCATACGTGGAGGCTGCTCCGGGACAAAATGAAGCCGTGTTCCAAGACCAAAAGGGTGTTGAATGTGGCCAATGGGAACCGATTGTGAATATCATGGACCCATACGTGCAAGAGTTGGGAAGGTTTGCTGTGATGGAGAACAATAAGAACACAATGGGACATCTTAAGTTCATTTGTGTGATAAAGGGGTGGACTCAAGTTGTAGCTGGAAAAAATTATCGGCTTATTATTGAAGCATGTAATGGACTTGGTTTCCCTGGGACTTATGAGGCTATTGTATATGTTAAGCCATGGGAGAAGACATGGGAGCTCATAGAGTTTATACCTTTACTCAGGAACTGA ATGAGTTCATACGTGGAGGCTGCTCCGGGACAAAATGAAGCCGTGTTCCAAGACCAAAAGGGTGTTGAATGTGGCCAATGGGAACCGATTGTGAATATCATGGACCCATACGTGCAAGAGTTGGGAAGGTTTGCTGTGATGGAGAACAATAAGAACACAATGGGACATCTTAAGTTCATTTGTGTGATAAAGGGGTGGACTCAAGTTGTAGCTGGAAAAAATTATCGGCTTATTATTGAAGCATGTAATGGACTTGGTTTCCCTGGGACTTATGAGGCTATTGTATATGTTAAGCCATGGGAGAAGACATGGGAGCTCATAGAGTTTATACCTTTACTCAGGAACTGA ATGAGTTCATACGTGGAGGCTGCTCCGGGACAAAATGAAGCCGTGTTCCAAGACCAAAAGGGTGTTGAATGTGGCCAATGGGAACCGATTGTGAATATCATGGACCCATACGTGCAAGAGTTGGGAAGGTTTGCTGTGATGGAGAACAATAAGAACACAATGGGACATCTTAAGTTCATTTGTGTGATAAAGGGGTGGACTCAAGTTGTAGCTGGAAAAAATTATCGGCTTATTATTGAAGCATGTAATGGACTTGGTTTCCCTGGGACTTATGAGGCTATTGTATATGTTAAGCCATGGGAGAAGACATGGGAGCTCATAGAGTTTATACCTTTACTCAGGAACTGA MSSYVEAAPGQNEAVFQDQKGVECGQWEPIVNIMDPYVQELGRFAVMENNKNTMGHLKFICVIKGWTQVVAGKNYRLIIEACNGLGFPGTYEAIVYVKPWEKTWELIEFIPLLRN Homology
BLAST of Cp4.1LG06g07940 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 87.0 bits (214), Expect = 1.5e-16 Identity = 44/87 (50.57%), Postives = 52/87 (59.77%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 85.1 bits (209), Expect = 5.6e-16 Identity = 43/96 (44.79%), Postives = 58/96 (60.42%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 3.6e-15 Identity = 42/96 (43.75%), Postives = 58/96 (60.42%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.8e-14 Identity = 42/85 (49.41%), Postives = 55/85 (64.71%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 4.4e-13 Identity = 35/87 (40.23%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. NCBI nr
Match: XP_023536176.1 (cysteine proteinase inhibitor A-like [Cucurbita pepo subsp. pepo] >XP_023536178.1 cysteine proteinase inhibitor A-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 250 bits (639), Expect = 4.46e-84 Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. NCBI nr
Match: XP_022936209.1 (cysteine proteinase inhibitor A-like [Cucurbita moschata] >XP_022936215.1 cysteine proteinase inhibitor A-like [Cucurbita moschata] >KAG6592146.1 Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia] >KAG6592149.1 Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 246 bits (628), Expect = 2.13e-82 Identity = 112/115 (97.39%), Postives = 114/115 (99.13%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. NCBI nr
Match: XP_022975708.1 (cysteine proteinase inhibitor A-like [Cucurbita maxima]) HSP 1 Score: 242 bits (617), Expect = 1.02e-80 Identity = 111/115 (96.52%), Postives = 112/115 (97.39%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. NCBI nr
Match: XP_022975710.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 171 bits (434), Expect = 7.98e-53 Identity = 79/115 (68.70%), Postives = 94/115 (81.74%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. NCBI nr
Match: XP_022936213.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 171 bits (434), Expect = 7.98e-53 Identity = 79/115 (68.70%), Postives = 95/115 (82.61%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. ExPASy TrEMBL
Match: A0A6J1F7N7 (cysteine proteinase inhibitor A-like OS=Cucurbita moschata OX=3662 GN=LOC111442883 PE=4 SV=1) HSP 1 Score: 246 bits (628), Expect = 1.03e-82 Identity = 112/115 (97.39%), Postives = 114/115 (99.13%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. ExPASy TrEMBL
Match: A0A6J1IK23 (cysteine proteinase inhibitor A-like OS=Cucurbita maxima OX=3661 GN=LOC111475738 PE=4 SV=1) HSP 1 Score: 242 bits (617), Expect = 4.91e-81 Identity = 111/115 (96.52%), Postives = 112/115 (97.39%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. ExPASy TrEMBL
Match: A0A6J1IHH5 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475753 PE=4 SV=1) HSP 1 Score: 171 bits (434), Expect = 3.87e-53 Identity = 79/115 (68.70%), Postives = 94/115 (81.74%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. ExPASy TrEMBL
Match: A0A6J1FCN1 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111442885 PE=4 SV=1) HSP 1 Score: 171 bits (434), Expect = 3.87e-53 Identity = 79/115 (68.70%), Postives = 95/115 (82.61%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. ExPASy TrEMBL
Match: A0A6J1FCN5 (cysteine proteinase inhibitor 8-like OS=Cucurbita moschata OX=3662 GN=LOC111442890 PE=4 SV=1) HSP 1 Score: 167 bits (423), Expect = 1.95e-51 Identity = 79/116 (68.10%), Postives = 94/116 (81.03%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 87.0 bits (214), Expect = 1.0e-17 Identity = 44/87 (50.57%), Postives = 52/87 (59.77%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 64.7 bits (156), Expect = 5.6e-11 Identity = 34/85 (40.00%), Postives = 49/85 (57.65%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 57.0 bits (136), Expect = 1.2e-08 Identity = 34/74 (45.95%), Postives = 41/74 (55.41%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 57.0 bits (136), Expect = 1.2e-08 Identity = 34/74 (45.95%), Postives = 41/74 (55.41%), Query Frame = 0
BLAST of Cp4.1LG06g07940 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 55.1 bits (131), Expect = 4.4e-08 Identity = 30/72 (41.67%), Postives = 41/72 (56.94%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|