Cp4.1LG06g07890 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCATACGTCGAAGCTTCTCCTGGGCAAAATGAAGCCTCGATTCAGGGTCCGAAAAATCTCGAATTTGGTCGATGGGAACCGATCGAGAAAATCACCCCATATGTGGAAGAGATGGGAAGGTTTGCAGTAATGGAGCACAATGAGCAAAGTGGGGAACATTTGAAATTCATTTGTGTGCTAAGGGGATGGAGCCAAATTGTAGCTGGAACGAATTATCGGCTTATTATTGAAGCGAGAAACGACATTGGTATGGCTTGGAATTATGAGGCTATGGTATATGATAAGCCATGGGAGAAGACATGGAAGCTCATAGAGTTTGTGCCTTTACTCAAGAATTGA ATGAGTTCATACGTCGAAGCTTCTCCTGGGCAAAATGAAGCCTCGATTCAGGGTCCGAAAAATCTCGAATTTGGTCGATGGGAACCGATCGAGAAAATCACCCCATATGTGGAAGAGATGGGAAGGTTTGCAGTAATGGAGCACAATGAGCAAAGTGGGGAACATTTGAAATTCATTTGTGTGCTAAGGGGATGGAGCCAAATTGTAGCTGGAACGAATTATCGGCTTATTATTGAAGCGAGAAACGACATTGGTATGGCTTGGAATTATGAGGCTATGGTATATGATAAGCCATGGGAGAAGACATGGAAGCTCATAGAGTTTGTGCCTTTACTCAAGAATTGA ATGAGTTCATACGTCGAAGCTTCTCCTGGGCAAAATGAAGCCTCGATTCAGGGTCCGAAAAATCTCGAATTTGGTCGATGGGAACCGATCGAGAAAATCACCCCATATGTGGAAGAGATGGGAAGGTTTGCAGTAATGGAGCACAATGAGCAAAGTGGGGAACATTTGAAATTCATTTGTGTGCTAAGGGGATGGAGCCAAATTGTAGCTGGAACGAATTATCGGCTTATTATTGAAGCGAGAAACGACATTGGTATGGCTTGGAATTATGAGGCTATGGTATATGATAAGCCATGGGAGAAGACATGGAAGCTCATAGAGTTTGTGCCTTTACTCAAGAATTGA MSSYVEASPGQNEASIQGPKNLEFGRWEPIEKITPYVEEMGRFAVMEHNEQSGEHLKFICVLRGWSQIVAGTNYRLIIEARNDIGMAWNYEAMVYDKPWEKTWKLIEFVPLLKN Homology
BLAST of Cp4.1LG06g07890 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 89.4 bits (220), Expect = 2.9e-17 Identity = 43/96 (44.79%), Postives = 65/96 (67.71%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 6.6e-17 Identity = 43/96 (44.79%), Postives = 65/96 (67.71%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 85.1 bits (209), Expect = 5.5e-16 Identity = 42/87 (48.28%), Postives = 57/87 (65.52%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 8.3e-12 Identity = 33/87 (37.93%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. ExPASy Swiss-Prot
Match: Q10Q47 (Putative cysteine proteinase inhibitor 7 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210100 PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 9.2e-11 Identity = 38/100 (38.00%), Postives = 55/100 (55.00%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. NCBI nr
Match: XP_022936213.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 232 bits (592), Expect = 6.15e-77 Identity = 105/114 (92.11%), Postives = 111/114 (97.37%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. NCBI nr
Match: KAG6592144.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 227 bits (578), Expect = 8.41e-75 Identity = 102/114 (89.47%), Postives = 111/114 (97.37%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. NCBI nr
Match: KAG6592148.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 226 bits (577), Expect = 1.23e-74 Identity = 102/114 (89.47%), Postives = 110/114 (96.49%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. NCBI nr
Match: XP_022975710.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 222 bits (565), Expect = 8.09e-73 Identity = 101/114 (88.60%), Postives = 109/114 (95.61%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. NCBI nr
Match: XP_038897049.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 175 bits (444), Expect = 2.37e-54 Identity = 82/115 (71.30%), Postives = 96/115 (83.48%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. ExPASy TrEMBL
Match: A0A6J1FCN1 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111442885 PE=4 SV=1) HSP 1 Score: 232 bits (592), Expect = 2.98e-77 Identity = 105/114 (92.11%), Postives = 111/114 (97.37%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. ExPASy TrEMBL
Match: A0A6J1IHH5 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475753 PE=4 SV=1) HSP 1 Score: 222 bits (565), Expect = 3.92e-73 Identity = 101/114 (88.60%), Postives = 109/114 (95.61%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. ExPASy TrEMBL
Match: A0A6J1IK23 (cysteine proteinase inhibitor A-like OS=Cucurbita maxima OX=3661 GN=LOC111475738 PE=4 SV=1) HSP 1 Score: 166 bits (421), Expect = 3.67e-51 Identity = 77/115 (66.96%), Postives = 94/115 (81.74%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. ExPASy TrEMBL
Match: A0A6J1F7N7 (cysteine proteinase inhibitor A-like OS=Cucurbita moschata OX=3662 GN=LOC111442883 PE=4 SV=1) HSP 1 Score: 166 bits (419), Expect = 7.40e-51 Identity = 76/115 (66.09%), Postives = 94/115 (81.74%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. ExPASy TrEMBL
Match: A0A6J1IDU0 (cysteine proteinase inhibitor 8-like OS=Cucurbita maxima OX=3661 GN=LOC111475783 PE=4 SV=1) HSP 1 Score: 157 bits (397), Expect = 1.72e-47 Identity = 76/116 (65.52%), Postives = 94/116 (81.03%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 85.1 bits (209), Expect = 3.9e-17 Identity = 42/87 (48.28%), Postives = 57/87 (65.52%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 64.3 bits (155), Expect = 7.2e-11 Identity = 34/88 (38.64%), Postives = 54/88 (61.36%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 60.5 bits (145), Expect = 1.0e-09 Identity = 29/72 (40.28%), Postives = 44/72 (61.11%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 56.6 bits (135), Expect = 1.5e-08 Identity = 32/82 (39.02%), Postives = 46/82 (56.10%), Query Frame = 0
BLAST of Cp4.1LG06g07890 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 56.6 bits (135), Expect = 1.5e-08 Identity = 32/82 (39.02%), Postives = 46/82 (56.10%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|