Cp4.1LG02g01710 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGAGCACAAATCTCCTCCAATTCCCTCTCCTTCAATTCCAATGCCGGCCACCGTCTACTTTCCTTTTTCCGGCCATCAAATCGCATGTCTCGGTCGTCTCAATCCCGTTTCCGAGTTCTCAATTCCTCCACAACCCTTCCCATGGTCCGGTGAGCTTCGTTCCAATGGCGAAATCTCCAAAAAGCGAGAGTTCAGAGCAGAAATTCAGTCATGAAGGCTCGGTTATCGAATCTCTTCCCAACGGAATGTTCAGAGTTCAATTGGACAATGAAGACCTAATTCTTGGCTACATCTCGGGTAAGATTCGGAAGAATTTCGTGCGTATTTTGCCTGGTGATAGGGTTAGGGTTGAAGTTAGCCGTTATGATTCTACTAAAGGCCGTATTGTCTATAGACATCGAAGTACTAAGGATCCATCTTCATGA ATGTCGAGCACAAATCTCCTCCAATTCCCTCTCCTTCAATTCCAATGCCGGCCACCGTCTACTTTCCTTTTTCCGGCCATCAAATCGCATGTCTCGGTCGTCTCAATCCCGTTTCCGAGTTCTCAATTCCTCCACAACCCTTCCCATGGTCCGGTGAGCTTCGTTCCAATGGCGAAATCTCCAAAAAGCGAGAGTTCAGAGCAGAAATTCAGTCATGAAGGCTCGGTTATCGAATCTCTTCCCAACGGAATGTTCAGAGTTCAATTGGACAATGAAGACCTAATTCTTGGCTACATCTCGGGTAAGATTCGGAAGAATTTCGTGCGTATTTTGCCTGGTGATAGGGTTAGGGTTGAAGTTAGCCGTTATGATTCTACTAAAGGCCGTATTGTCTATAGACATCGAAGTACTAAGGATCCATCTTCATGA ATGTCGAGCACAAATCTCCTCCAATTCCCTCTCCTTCAATTCCAATGCCGGCCACCGTCTACTTTCCTTTTTCCGGCCATCAAATCGCATGTCTCGGTCGTCTCAATCCCGTTTCCGAGTTCTCAATTCCTCCACAACCCTTCCCATGGTCCGGTGAGCTTCGTTCCAATGGCGAAATCTCCAAAAAGCGAGAGTTCAGAGCAGAAATTCAGTCATGAAGGCTCGGTTATCGAATCTCTTCCCAACGGAATGTTCAGAGTTCAATTGGACAATGAAGACCTAATTCTTGGCTACATCTCGGGTAAGATTCGGAAGAATTTCGTGCGTATTTTGCCTGGTGATAGGGTTAGGGTTGAAGTTAGCCGTTATGATTCTACTAAAGGCCGTATTGTCTATAGACATCGAAGTACTAAGGATCCATCTTCATGA MSSTNLLQFPLLQFQCRPPSTFLFPAIKSHVSVVSIPFPSSQFLHNPSHGPVSFVPMAKSPKSESSEQKFSHEGSVIESLPNGMFRVQLDNEDLILGYISGKIRKNFVRILPGDRVRVEVSRYDSTKGRIVYRHRSTKDPSS Homology
BLAST of Cp4.1LG02g01710 vs. ExPASy Swiss-Prot
Match: Q94KR7 (Translation initiation factor IF-1, chloroplastic OS=Glycine max OX=3847 GN=infA PE=2 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 6.0e-28 Identity = 65/91 (71.43%), Postives = 76/91 (83.52%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. ExPASy Swiss-Prot
Match: Q94KR9 (Translation initiation factor IF-1, chloroplastic OS=Solanum lycopersicum OX=4081 GN=infA PE=2 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 2.3e-27 Identity = 55/75 (73.33%), Postives = 69/75 (92.00%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. ExPASy Swiss-Prot
Match: A6MMP2 (Translation initiation factor IF-1, chloroplastic OS=Dioscorea elephantipes OX=145284 GN=infA PE=3 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 8.7e-27 Identity = 55/70 (78.57%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. ExPASy Swiss-Prot
Match: A0A370 (Translation initiation factor IF-1, chloroplastic OS=Coffea arabica OX=13443 GN=infA PE=3 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 1.1e-26 Identity = 54/70 (77.14%), Postives = 67/70 (95.71%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. ExPASy Swiss-Prot
Match: Q09G11 (Translation initiation factor IF-1, chloroplastic OS=Platanus occidentalis OX=4403 GN=infA PE=3 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 1.1e-26 Identity = 55/70 (78.57%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. NCBI nr
Match: XP_022940969.1 (translation initiation factor IF-1, chloroplastic-like [Cucurbita moschata] >XP_023525132.1 translation initiation factor IF-1, chloroplastic-like [Cucurbita pepo subsp. pepo] >KAG7037405.1 Translation initiation factor IF-1, chloroplastic, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 281 bits (720), Expect = 1.48e-95 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. NCBI nr
Match: KAG6607876.1 (Translation initiation factor IF-1, chloroplastic, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 276 bits (705), Expect = 2.87e-93 Identity = 139/142 (97.89%), Postives = 140/142 (98.59%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. NCBI nr
Match: XP_022981301.1 (translation initiation factor IF-1, chloroplastic-like [Cucurbita maxima]) HSP 1 Score: 268 bits (686), Expect = 2.27e-90 Identity = 135/142 (95.07%), Postives = 136/142 (95.77%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. NCBI nr
Match: XP_011654076.1 (uncharacterized protein LOC101206284 [Cucumis sativus] >KGN55131.1 hypothetical protein Csa_012104 [Cucumis sativus]) HSP 1 Score: 231 bits (588), Expect = 1.98e-75 Identity = 117/142 (82.39%), Postives = 128/142 (90.14%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. NCBI nr
Match: KAA0064332.1 (translation initiation factor IF-1 [Cucumis melo var. makuwa] >TYK20254.1 translation initiation factor IF-1 [Cucumis melo var. makuwa]) HSP 1 Score: 227 bits (579), Expect = 4.83e-74 Identity = 118/143 (82.52%), Postives = 127/143 (88.81%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. ExPASy TrEMBL
Match: A0A6J1FLU6 (translation initiation factor IF-1, chloroplastic-like OS=Cucurbita moschata OX=3662 GN=LOC111446393 PE=3 SV=1) HSP 1 Score: 281 bits (720), Expect = 7.17e-96 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. ExPASy TrEMBL
Match: A0A6J1IW62 (translation initiation factor IF-1, chloroplastic-like OS=Cucurbita maxima OX=3661 GN=LOC111480474 PE=3 SV=1) HSP 1 Score: 268 bits (686), Expect = 1.10e-90 Identity = 135/142 (95.07%), Postives = 136/142 (95.77%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. ExPASy TrEMBL
Match: A0A0A0L4Q7 (S1-like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G637710 PE=3 SV=1) HSP 1 Score: 231 bits (588), Expect = 9.61e-76 Identity = 117/142 (82.39%), Postives = 128/142 (90.14%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. ExPASy TrEMBL
Match: A0A5A7V7J3 (Translation initiation factor IF-1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold134G003940 PE=3 SV=1) HSP 1 Score: 227 bits (579), Expect = 2.34e-74 Identity = 118/143 (82.52%), Postives = 127/143 (88.81%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. ExPASy TrEMBL
Match: A0A6J1IP00 (uncharacterized protein LOC111476947 OS=Cucurbita maxima OX=3661 GN=LOC111476947 PE=3 SV=1) HSP 1 Score: 222 bits (565), Expect = 2.69e-72 Identity = 111/137 (81.02%), Postives = 123/137 (89.78%), Query Frame = 0
BLAST of Cp4.1LG02g01710 vs. TAIR 10
Match: AT4G11175.1 (Nucleic acid-binding, OB-fold-like protein ) HSP 1 Score: 100.9 bits (250), Expect = 8.6e-22 Identity = 50/76 (65.79%), Postives = 59/76 (77.63%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|