CmoCh13G007360 (gene) Cucurbita moschata (Rifu) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGTACCTGCACGAAGATTCTCGTCTTCGAGTTATTCATCGTAATCTTAAAGCGAGTAACATCTTGTTAGATGAATATATGAACGCGAAAATTTCGAATTTTGGTCTGGGAAGAATAATTCAAGAGGATCAAACTCAAGAAAATACAAATAAAATCGTCGGTACCTAGTAAATTTTTCTTCTTACCTTAAATTTTTCTCTTACTTACCATGATCATTATTGACAATTTTTGTGTTTCAGTGGTTATGTCTCTTGAGTATGCAATGCATGGAGTTTTCTCAATGAAATTTGATGTGTATAGCTTTGGAGTCTTGGTGTTGGAGATTTTAAGTGGTTGA ATGTTGTACCTGCACGAAGATTCTCGTCTTCGAGTTATTCATCGTAATCTTAAAGCGAGTAACATCTTGTTAGATGAATATATGAACGCGAAAATTTCGAATTTTGGTCTGGGAAGAATAATTCAAGAGGATCAAACTCAAGAAAATACAAATAAAATCGTCGTGGTTATGTCTCTTGAGTATGCAATGCATGGAGTTTTCTCAATGAAATTTGATGTGTATAGCTTTGGAGTCTTGGTGTTGGAGATTTTAAGTGGTTGA ATGTTGTACCTGCACGAAGATTCTCGTCTTCGAGTTATTCATCGTAATCTTAAAGCGAGTAACATCTTGTTAGATGAATATATGAACGCGAAAATTTCGAATTTTGGTCTGGGAAGAATAATTCAAGAGGATCAAACTCAAGAAAATACAAATAAAATCGTCGTGGTTATGTCTCTTGAGTATGCAATGCATGGAGTTTTCTCAATGAAATTTGATGTGTATAGCTTTGGAGTCTTGGTGTTGGAGATTTTAAGTGGTTGA MLYLHEDSRLRVIHRNLKASNILLDEYMNAKISNFGLGRIIQEDQTQENTNKIVVVMSLEYAMHGVFSMKFDVYSFGVLVLEILSG Homology
BLAST of CmoCh13G007360 vs. ExPASy Swiss-Prot
Match: Q8GYA4 (Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana OX=3702 GN=CRK10 PE=1 SV=3) HSP 1 Score: 115.2 bits (287), Expect = 3.8e-25 Identity = 61/89 (68.54%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of CmoCh13G007360 vs. ExPASy Swiss-Prot
Match: Q8W4G6 (Cysteine-rich receptor-like protein kinase 15 OS=Arabidopsis thaliana OX=3702 GN=CRK15 PE=2 SV=2) HSP 1 Score: 113.6 bits (283), Expect = 1.1e-24 Identity = 60/89 (67.42%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of CmoCh13G007360 vs. ExPASy Swiss-Prot
Match: Q9C5S9 (Cysteine-rich receptor-like protein kinase 6 OS=Arabidopsis thaliana OX=3702 GN=CRK6 PE=1 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 1.1e-24 Identity = 60/89 (67.42%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of CmoCh13G007360 vs. ExPASy Swiss-Prot
Match: Q8L7G3 (Cysteine-rich receptor-like protein kinase 7 OS=Arabidopsis thaliana OX=3702 GN=CRK7 PE=2 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 1.1e-24 Identity = 61/89 (68.54%), Postives = 72/89 (80.90%), Query Frame = 0
BLAST of CmoCh13G007360 vs. ExPASy Swiss-Prot
Match: O65468 (Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana OX=3702 GN=CRK8 PE=3 SV=2) HSP 1 Score: 113.6 bits (283), Expect = 1.1e-24 Identity = 60/89 (67.42%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of CmoCh13G007360 vs. ExPASy TrEMBL
Match: A0A6J1KPY4 (cysteine-rich receptor-like protein kinase 10 OS=Cucurbita maxima OX=3661 GN=LOC111495427 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 4.9e-28 Identity = 70/89 (78.65%), Postives = 78/89 (87.64%), Query Frame = 0
BLAST of CmoCh13G007360 vs. ExPASy TrEMBL
Match: A0A6J1F417 (cysteine-rich receptor-like protein kinase 10 OS=Cucurbita moschata OX=3662 GN=LOC111440040 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 4.9e-28 Identity = 70/89 (78.65%), Postives = 78/89 (87.64%), Query Frame = 0
BLAST of CmoCh13G007360 vs. ExPASy TrEMBL
Match: A0A059CB50 (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_E04150 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 6.7e-25 Identity = 65/89 (73.03%), Postives = 74/89 (83.15%), Query Frame = 0
BLAST of CmoCh13G007360 vs. ExPASy TrEMBL
Match: A0A059CAP9 (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_E03762 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 6.7e-25 Identity = 65/89 (73.03%), Postives = 74/89 (83.15%), Query Frame = 0
BLAST of CmoCh13G007360 vs. ExPASy TrEMBL
Match: A0A6J1CGV0 (putative receptor-like protein kinase At4g00960 OS=Momordica charantia OX=3673 GN=LOC111010733 PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 8.7e-25 Identity = 64/89 (71.91%), Postives = 74/89 (83.15%), Query Frame = 0
BLAST of CmoCh13G007360 vs. NCBI nr
Match: XP_023519606.1 (cysteine-rich receptor-like protein kinase 10 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 133.3 bits (334), Expect = 1.0e-27 Identity = 70/89 (78.65%), Postives = 78/89 (87.64%), Query Frame = 0
BLAST of CmoCh13G007360 vs. NCBI nr
Match: XP_022933188.1 (cysteine-rich receptor-like protein kinase 10 [Cucurbita moschata]) HSP 1 Score: 133.3 bits (334), Expect = 1.0e-27 Identity = 70/89 (78.65%), Postives = 78/89 (87.64%), Query Frame = 0
BLAST of CmoCh13G007360 vs. NCBI nr
Match: XP_023001238.1 (cysteine-rich receptor-like protein kinase 10 [Cucurbita maxima]) HSP 1 Score: 133.3 bits (334), Expect = 1.0e-27 Identity = 70/89 (78.65%), Postives = 78/89 (87.64%), Query Frame = 0
BLAST of CmoCh13G007360 vs. NCBI nr
Match: XP_038893612.1 (cysteine-rich receptor-like protein kinase 10 isoform X2 [Benincasa hispida]) HSP 1 Score: 125.9 bits (315), Expect = 1.6e-25 Identity = 69/89 (77.53%), Postives = 76/89 (85.39%), Query Frame = 0
BLAST of CmoCh13G007360 vs. NCBI nr
Match: XP_038893611.1 (cysteine-rich receptor-like protein kinase 10 isoform X1 [Benincasa hispida]) HSP 1 Score: 125.9 bits (315), Expect = 1.6e-25 Identity = 69/89 (77.53%), Postives = 76/89 (85.39%), Query Frame = 0
BLAST of CmoCh13G007360 vs. TAIR 10
Match: AT4G23180.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 10 ) HSP 1 Score: 115.2 bits (287), Expect = 2.7e-26 Identity = 61/89 (68.54%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of CmoCh13G007360 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 113.6 bits (283), Expect = 7.8e-26 Identity = 60/89 (67.42%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of CmoCh13G007360 vs. TAIR 10
Match: AT4G23230.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 15 ) HSP 1 Score: 113.6 bits (283), Expect = 7.8e-26 Identity = 60/89 (67.42%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of CmoCh13G007360 vs. TAIR 10
Match: AT4G23150.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 7 ) HSP 1 Score: 113.6 bits (283), Expect = 7.8e-26 Identity = 61/89 (68.54%), Postives = 72/89 (80.90%), Query Frame = 0
BLAST of CmoCh13G007360 vs. TAIR 10
Match: AT4G23140.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 6 ) HSP 1 Score: 113.6 bits (283), Expect = 7.8e-26 Identity = 60/89 (67.42%), Postives = 73/89 (82.02%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita moschata (Rifu) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|