Cmc08g0215881 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTTGATTTTTGCCATTATTTCTACATTAGCCCTTCTTGCTCTTACTCTTCTCTTCAAAGTCTACCCCTTCAAAGCCCAAAAATTGCCTCCTGGTCCTATAGGATTTCCCATTATTGGTAGCCTCCATTTATTAGGAAAGCTTCCTCATAGAGATTTTCATATATTATCCCAAAAATATGGACCCATTATGCACATAAGACTAGGCCTTGTTCCCACAATCATAGTCTCTTCTCCTAAAGCTGCTGAACTCTTCCTCAGAACTCATGATCTTGTCTTTGCAAGCAGGCCCCTTTCAGATCAGCCTCAAAGCAAATGA ATGGCTTTGATTTTTGCCATTATTTCTACATTAGCCCTTCTTGCTCTTACTCTTCTCTTCAAAGTCTACCCCTTCAAAGCCCAAAAATTGCCTCCTGGTCCTATAGGATTTCCCATTATTGGTAGCCTCCATTTATTAGGAAAGCTTCCTCATAGAGATTTTCATATATTATCCCAAAAATATGGACCCATTATGCACATAAGACTAGGCCTTGTTCCCACAATCATAGTCTCTTCTCCTAAAGCTGCTGAACTCTTCCTCAGAACTCATGATCTTGTCTTTGCAAGCAGGCCCCTTTCAGATCAGCCTCAAAGCAAATGA ATGGCTTTGATTTTTGCCATTATTTCTACATTAGCCCTTCTTGCTCTTACTCTTCTCTTCAAAGTCTACCCCTTCAAAGCCCAAAAATTGCCTCCTGGTCCTATAGGATTTCCCATTATTGGTAGCCTCCATTTATTAGGAAAGCTTCCTCATAGAGATTTTCATATATTATCCCAAAAATATGGACCCATTATGCACATAAGACTAGGCCTTGTTCCCACAATCATAGTCTCTTCTCCTAAAGCTGCTGAACTCTTCCTCAGAACTCATGATCTTGTCTTTGCAAGCAGGCCCCTTTCAGATCAGCCTCAAAGCAAATGA MALIFAIISTLALLALTLLFKVYPFKAQKLPPGPIGFPIIGSLHLLGKLPHRDFHILSQKYGPIMHIRLGLVPTIIVSSPKAAELFLRTHDLVFASRPLSDQPQSK Homology
BLAST of Cmc08g0215881 vs. NCBI nr
Match: XP_011657998.2 (cytochrome P450 CYP736A12 [Cucumis sativus]) HSP 1 Score: 187.2 bits (474), Expect = 7.3e-44 Identity = 94/99 (94.95%), Postives = 97/99 (97.98%), Query Frame = 0
BLAST of Cmc08g0215881 vs. NCBI nr
Match: XP_016899182.1 (PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]) HSP 1 Score: 180.3 bits (456), Expect = 9.0e-42 Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Cmc08g0215881 vs. NCBI nr
Match: XP_038881390.1 (cytochrome P450 71AU50-like [Benincasa hispida]) HSP 1 Score: 166.8 bits (421), Expect = 1.0e-37 Identity = 84/101 (83.17%), Postives = 91/101 (90.10%), Query Frame = 0
BLAST of Cmc08g0215881 vs. NCBI nr
Match: XP_022132547.1 (cytochrome P450 CYP736A12-like [Momordica charantia]) HSP 1 Score: 141.4 bits (355), Expect = 4.6e-30 Identity = 76/101 (75.25%), Postives = 84/101 (83.17%), Query Frame = 0
BLAST of Cmc08g0215881 vs. NCBI nr
Match: XP_038882277.1 (cytochrome P450 71AU50-like [Benincasa hispida]) HSP 1 Score: 136.0 bits (341), Expect = 1.9e-28 Identity = 69/99 (69.70%), Postives = 80/99 (80.81%), Query Frame = 0
BLAST of Cmc08g0215881 vs. ExPASy Swiss-Prot
Match: A0A068Q5V6 (Cytochrome P450 71AU50 OS=Prunus mume OX=102107 GN=CYP71AU50 PE=2 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 3.2e-26 Identity = 58/93 (62.37%), Postives = 77/93 (82.80%), Query Frame = 0
BLAST of Cmc08g0215881 vs. ExPASy Swiss-Prot
Match: H2DH18 (Cytochrome P450 CYP736A12 OS=Panax ginseng OX=4054 PE=2 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.5e-23 Identity = 58/97 (59.79%), Postives = 71/97 (73.20%), Query Frame = 0
BLAST of Cmc08g0215881 vs. ExPASy Swiss-Prot
Match: Q9LXM3 (Cytochrome P450 71B38 OS=Arabidopsis thaliana OX=3702 GN=CYP71B38 PE=2 SV=2) HSP 1 Score: 97.4 bits (241), Expect = 1.0e-19 Identity = 52/95 (54.74%), Postives = 67/95 (70.53%), Query Frame = 0
BLAST of Cmc08g0215881 vs. ExPASy Swiss-Prot
Match: Q9LTM1 (Cytochrome P450 71B22 OS=Arabidopsis thaliana OX=3702 GN=CYP71B22 PE=2 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.3e-19 Identity = 51/90 (56.67%), Postives = 64/90 (71.11%), Query Frame = 0
BLAST of Cmc08g0215881 vs. ExPASy Swiss-Prot
Match: O48958 (4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor OX=4558 GN=CYP71E1 PE=1 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.5e-18 Identity = 41/78 (52.56%), Postives = 57/78 (73.08%), Query Frame = 0
BLAST of Cmc08g0215881 vs. ExPASy TrEMBL
Match: A0A0A0KJ01 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G501340 PE=3 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 3.6e-44 Identity = 94/99 (94.95%), Postives = 97/99 (97.98%), Query Frame = 0
BLAST of Cmc08g0215881 vs. ExPASy TrEMBL
Match: A0A1S4DT57 (cytochrome P450 CYP736A12-like OS=Cucumis melo OX=3656 GN=LOC103485292 PE=3 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 4.4e-42 Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Cmc08g0215881 vs. ExPASy TrEMBL
Match: A0A6J1BU49 (cytochrome P450 CYP736A12-like OS=Momordica charantia OX=3673 GN=LOC111005380 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 2.2e-30 Identity = 76/101 (75.25%), Postives = 84/101 (83.17%), Query Frame = 0
BLAST of Cmc08g0215881 vs. ExPASy TrEMBL
Match: A0A6J1BVB2 (cytochrome P450 CYP736A12-like OS=Momordica charantia OX=3673 GN=LOC111005855 PE=3 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 1.2e-28 Identity = 69/95 (72.63%), Postives = 80/95 (84.21%), Query Frame = 0
BLAST of Cmc08g0215881 vs. ExPASy TrEMBL
Match: A0A6P3YU66 (cytochrome P450 CYP736A12-like OS=Ziziphus jujuba OX=326968 GN=LOC107404788 PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 1.6e-28 Identity = 69/98 (70.41%), Postives = 83/98 (84.69%), Query Frame = 0
BLAST of Cmc08g0215881 vs. TAIR 10
Match: AT3G44250.1 (cytochrome P450, family 71, subfamily B, polypeptide 38 ) HSP 1 Score: 97.4 bits (241), Expect = 7.1e-21 Identity = 52/95 (54.74%), Postives = 67/95 (70.53%), Query Frame = 0
BLAST of Cmc08g0215881 vs. TAIR 10
Match: AT3G26200.1 (cytochrome P450, family 71, subfamily B, polypeptide 22 ) HSP 1 Score: 97.1 bits (240), Expect = 9.3e-21 Identity = 51/90 (56.67%), Postives = 64/90 (71.11%), Query Frame = 0
BLAST of Cmc08g0215881 vs. TAIR 10
Match: AT3G26190.1 (cytochrome P450, family 71, subfamily B, polypeptide 21 ) HSP 1 Score: 92.8 bits (229), Expect = 1.8e-19 Identity = 49/90 (54.44%), Postives = 64/90 (71.11%), Query Frame = 0
BLAST of Cmc08g0215881 vs. TAIR 10
Match: AT3G53280.1 (cytochrome p450 71b5 ) HSP 1 Score: 90.1 bits (222), Expect = 1.1e-18 Identity = 49/95 (51.58%), Postives = 61/95 (64.21%), Query Frame = 0
BLAST of Cmc08g0215881 vs. TAIR 10
Match: AT3G26270.1 (cytochrome P450, family 71, subfamily B, polypeptide 25 ) HSP 1 Score: 87.0 bits (214), Expect = 9.6e-18 Identity = 45/95 (47.37%), Postives = 62/95 (65.26%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|