CmaCh03G014390 (gene) Cucurbita maxima (Rimu) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGTTCTTCCACACCAATCCAATTGGACGAATTATCAATAGGTTTGCCAAAGATCTTGGAGACATTGATCGTACTCTTGCCCATATTATGAATATGTTTCTTGGACAACTGTGGCAGCTACTGTCAACTTTTGTTCTAATAGGTCTAGTGAGCCCAATCTCCCTATGGGCCATTACGCCGCTATTGATTGTGTTTTATGCAGTCTATTTATATTATCAGGTATGA ATGGTGTTCTTCCACACCAATCCAATTGGACGAATTATCAATAGGTTTGCCAAAGATCTTGGAGACATTGATCGTACTCTTGCCCATATTATGAATATGTTTCTTGGACAACTGTGGCAGCTACTGTCAACTTTTGTTCTAATAGGTCTAGTGAGCCCAATCTCCCTATGGGCCATTACGCCGCTATTGATTGTATGA ATGGTGTTCTTCCACACCAATCCAATTGGACGAATTATCAATAGGTTTGCCAAAGATCTTGGAGACATTGATCGTACTCTTGCCCATATTATGAATATGTTTCTTGGACAACTGTGGCAGCTACTGTCAACTTTTGTTCTAATAGGTCTAGTGAGCCCAATCTCCCTATGGGCCATTACGCCGCTATTGATTGTATGA MVFFHTNPIGRIINRFAKDLGDIDRTLAHIMNMFLGQLWQLLSTFVLIGLVSPISLWAITPLLIV Homology
BLAST of CmaCh03G014390 vs. ExPASy Swiss-Prot
Match: Q9C8H0 (ABC transporter C family member 12 OS=Arabidopsis thaliana OX=3702 GN=ABCC12 PE=2 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 6.6e-22 Identity = 49/65 (75.38%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of CmaCh03G014390 vs. ExPASy Swiss-Prot
Match: Q9C8H1 (ABC transporter C family member 11 OS=Arabidopsis thaliana OX=3702 GN=ABCC11 PE=2 SV=2) HSP 1 Score: 102.1 bits (253), Expect = 2.5e-21 Identity = 48/65 (73.85%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of CmaCh03G014390 vs. ExPASy Swiss-Prot
Match: Q42093 (ABC transporter C family member 2 OS=Arabidopsis thaliana OX=3702 GN=ABCC2 PE=1 SV=2) HSP 1 Score: 99.0 bits (245), Expect = 2.1e-20 Identity = 49/65 (75.38%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of CmaCh03G014390 vs. ExPASy Swiss-Prot
Match: Q9C8G9 (ABC transporter C family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCC1 PE=1 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.1e-19 Identity = 47/65 (72.31%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of CmaCh03G014390 vs. ExPASy Swiss-Prot
Match: Q54P13 (ABC transporter C family member 8 OS=Dictyostelium discoideum OX=44689 GN=abcC8 PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.1e-07 Identity = 27/62 (43.55%), Postives = 40/62 (64.52%), Query Frame = 0
BLAST of CmaCh03G014390 vs. ExPASy TrEMBL
Match: A0A6J1IIS6 (ABC transporter C family member 12-like OS=Cucurbita maxima OX=3661 GN=LOC111477835 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 7.1e-27 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of CmaCh03G014390 vs. ExPASy TrEMBL
Match: A0A6J1EDU0 (ABC transporter C family member 12-like isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111433259 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 7.1e-27 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of CmaCh03G014390 vs. ExPASy TrEMBL
Match: A0A6J1EJU2 (ABC transporter C family member 12-like isoform X2 OS=Cucurbita moschata OX=3662 GN=LOC111433259 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 7.1e-27 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of CmaCh03G014390 vs. ExPASy TrEMBL
Match: A0A6J1IIR6 (ABC transporter C family member 12-like OS=Cucurbita maxima OX=3661 GN=LOC111477831 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 8.6e-25 Identity = 62/65 (95.38%), Postives = 64/65 (98.46%), Query Frame = 0
BLAST of CmaCh03G014390 vs. ExPASy TrEMBL
Match: A0A6J1ED72 (ABC transporter C family member 12-like OS=Cucurbita moschata OX=3662 GN=LOC111433258 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 8.6e-25 Identity = 62/65 (95.38%), Postives = 64/65 (98.46%), Query Frame = 0
BLAST of CmaCh03G014390 vs. NCBI nr
Match: XP_022926015.1 (ABC transporter C family member 12-like isoform X2 [Cucurbita moschata]) HSP 1 Score: 129.0 bits (323), Expect = 1.5e-26 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of CmaCh03G014390 vs. NCBI nr
Match: XP_022977532.1 (ABC transporter C family member 12-like [Cucurbita maxima]) HSP 1 Score: 129.0 bits (323), Expect = 1.5e-26 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of CmaCh03G014390 vs. NCBI nr
Match: KAG6581465.1 (ABC transporter C family member 12, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 129.0 bits (323), Expect = 1.5e-26 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of CmaCh03G014390 vs. NCBI nr
Match: XP_022926014.1 (ABC transporter C family member 12-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 129.0 bits (323), Expect = 1.5e-26 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of CmaCh03G014390 vs. NCBI nr
Match: KAG6581464.1 (ABC transporter C family member 2, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 125.9 bits (315), Expect = 1.2e-25 Identity = 63/65 (96.92%), Postives = 64/65 (98.46%), Query Frame = 0
BLAST of CmaCh03G014390 vs. TAIR 10
Match: AT1G30410.1 (multidrug resistance-associated protein 13 ) HSP 1 Score: 104.0 bits (258), Expect = 4.7e-23 Identity = 49/65 (75.38%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of CmaCh03G014390 vs. TAIR 10
Match: AT1G30420.1 (multidrug resistance-associated protein 12 ) HSP 1 Score: 102.1 bits (253), Expect = 1.8e-22 Identity = 48/65 (73.85%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of CmaCh03G014390 vs. TAIR 10
Match: AT2G34660.1 (multidrug resistance-associated protein 2 ) HSP 1 Score: 99.0 bits (245), Expect = 1.5e-21 Identity = 49/65 (75.38%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of CmaCh03G014390 vs. TAIR 10
Match: AT2G34660.2 (multidrug resistance-associated protein 2 ) HSP 1 Score: 99.0 bits (245), Expect = 1.5e-21 Identity = 49/65 (75.38%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of CmaCh03G014390 vs. TAIR 10
Match: AT1G30400.1 (multidrug resistance-associated protein 1 ) HSP 1 Score: 96.7 bits (239), Expect = 7.5e-21 Identity = 47/65 (72.31%), Postives = 57/65 (87.69%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita maxima (Rimu) v1.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|