Clc07G08105 (gene) Watermelon (cordophanus) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACATATAATTGTGATTGTTACAAACGTACGGGGTCGGTTAATTTTCTAGTCCTCTACGGATACGTGTGGATTCAAAGGTACAAGAAGAGGGACACTATTTGCCACTCAAACCACAGCAGAAAATGCTATTCGGGCAGTAGTTGATCAAGGTATGCAACGATCCGAAGTTATGATAAAGGGCCCTGGTCTAGAGTTCTATCATTAA ATGACATATAATTGTGATTGTTACAAACGTACGGGGTCGTCCTCTACGGATACGTGTGGATTCAAAGGTACAAGAAGAGGGACACTATTTGCCACTCAAACCACAGCAGAAAATGCTATTCGGGCAGTAGTTGATCAAGGTATGCAACGATCCGAAGTTATGATAAAGGGCCCTGGTCTAGAGTTCTATCATTAA ATGACATATAATTGTGATTGTTACAAACGTACGGGGTCGTCCTCTACGGATACGTGTGGATTCAAAGGTACAAGAAGAGGGACACTATTTGCCACTCAAACCACAGCAGAAAATGCTATTCGGGCAGTAGTTGATCAAGGTATGCAACGATCCGAAGTTATGATAAAGGGCCCTGGTCTAGAGTTCTATCATTAA MTYNCDCYKRTGSSSTDTCGFKGTRRGTLFATQTTAENAIRAVVDQGMQRSEVMIKGPGLEFYH Homology
BLAST of Clc07G08105 vs. NCBI nr
Match: QYH50881.1 (ribosomal protein S11 [Saussurea tanguensis]) HSP 1 Score: 81.3 bits (199), Expect = 3.4e-12 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of Clc07G08105 vs. NCBI nr
Match: YP_009634717.1 (ribosomal protein S11 [Nyctanthes arbor-tristis] >QBS49769.1 ribosomal protein S11 [Nyctanthes arbor-tristis]) HSP 1 Score: 80.9 bits (198), Expect = 4.5e-12 Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Clc07G08105 vs. NCBI nr
Match: KAD4981935.1 (hypothetical protein E3N88_18606 [Mikania micrantha]) HSP 1 Score: 80.9 bits (198), Expect = 4.5e-12 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of Clc07G08105 vs. NCBI nr
Match: YP_009905930.1 (ribosomal protein S11 [Vasconcellea cundinamarcensis] >QLG90337.1 ribosomal protein S11 [Vasconcellea cundinamarcensis]) HSP 1 Score: 80.5 bits (197), Expect = 5.8e-12 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of Clc07G08105 vs. NCBI nr
Match: YP_009752191.1 (ribosomal protein S11 [Linnaeosicyos amara] >QIT05601.1 ribosomal protein S11 [Linnaeosicyos amara]) HSP 1 Score: 80.5 bits (197), Expect = 5.8e-12 Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Clc07G08105 vs. ExPASy Swiss-Prot
Match: A0ZZ68 (30S ribosomal protein S11, chloroplastic OS=Gossypium barbadense OX=3634 GN=rps11 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.3e-14 Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Clc07G08105 vs. ExPASy Swiss-Prot
Match: Q2L937 (30S ribosomal protein S11, chloroplastic OS=Gossypium hirsutum OX=3635 GN=rps11 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.3e-14 Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Clc07G08105 vs. ExPASy Swiss-Prot
Match: Q6EW19 (30S ribosomal protein S11, chloroplastic OS=Nymphaea alba OX=34301 GN=rps11 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.3e-14 Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Clc07G08105 vs. ExPASy Swiss-Prot
Match: B2LMM6 (30S ribosomal protein S11, chloroplastic OS=Guizotia abyssinica OX=4230 GN=rps11 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.2e-14 Identity = 39/47 (82.98%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Clc07G08105 vs. ExPASy Swiss-Prot
Match: B1A968 (30S ribosomal protein S11, chloroplastic OS=Carica papaya OX=3649 GN=rps11 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 2.9e-14 Identity = 39/47 (82.98%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Clc07G08105 vs. ExPASy TrEMBL
Match: A0A5N6NML1 (S1-like domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_18606 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 2.2e-12 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of Clc07G08105 vs. ExPASy TrEMBL
Match: A0A4D5Y202 (30S ribosomal protein S11, chloroplastic OS=Nyctanthes arbor-tristis OX=41398 GN=rps11 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 2.2e-12 Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Clc07G08105 vs. ExPASy TrEMBL
Match: A0A7D5QJ83 (30S ribosomal protein S11, chloroplastic OS=Vasconcellea cundinamarcensis OX=35926 GN=rps11 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 2.8e-12 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of Clc07G08105 vs. ExPASy TrEMBL
Match: A0A6H0ETH3 (30S ribosomal protein S11, chloroplastic OS=Linnaeosicyos amara OX=386243 GN=rps11 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 2.8e-12 Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Clc07G08105 vs. ExPASy TrEMBL
Match: A0A6M3RIU1 (30S ribosomal protein S11, chloroplastic OS=Euphorbia larica OX=1031526 GN=rps11 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 2.8e-12 Identity = 40/47 (85.11%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Clc07G08105 vs. TAIR 10
Match: ATCG00750.1 (ribosomal protein S11 ) HSP 1 Score: 76.3 bits (186), Expect = 1.0e-14 Identity = 38/47 (80.85%), Postives = 40/47 (85.11%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (cordophanus) v2
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|