Cla97C08G159420 (gene) Watermelon (97103) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTGTCATGGTGTAAGCAAGCTCCATTTCTCCAGGGAAGAGATGAAGGAAATCTTCCGAGAGCACGACATCGACGGAGACGGTTACCTCAGCATCAGTGAGCTCATCAAAGCCATGGGGTTTTTGGGTCACTCTATACCATTCTACAAAGCTCATTACGGTATGGCTTATTCTGATGAGAATGGTGACGGCTTCATCTCTGAAGATGAGCTTGACAAACTCATTGATTATGTCGAAAAGTTTCAGTACAATAAGCGTTAA ATGGCTTGTCATGGTGTAAGCAAGCTCCATTTCTCCAGGGAAGAGATGAAGGAAATCTTCCGAGAGCACGACATCGACGGAGACGGTTACCTCAGCATCAGTGAGCTCATCAAAGCCATGGGGTTTTTGGGTCACTCTATACCATTCTACAAAGCTCATTACGGTATGGCTTATTCTGATGAGAATGGTGACGGCTTCATCTCTGAAGATGAGCTTGACAAACTCATTGATTATGTCGAAAAGTTTCAGTACAATAAGCGTTAA ATGGCTTGTCATGGTGTAAGCAAGCTCCATTTCTCCAGGGAAGAGATGAAGGAAATCTTCCGAGAGCACGACATCGACGGAGACGGTTACCTCAGCATCAGTGAGCTCATCAAAGCCATGGGGTTTTTGGGTCACTCTATACCATTCTACAAAGCTCATTACGGTATGGCTTATTCTGATGAGAATGGTGACGGCTTCATCTCTGAAGATGAGCTTGACAAACTCATTGATTATGTCGAAAAGTTTCAGTACAATAAGCGTTAA MACHGVSKLHFSREEMKEIFREHDIDGDGYLSISELIKAMGFLGHSIPFYKAHYGMAYSDENGDGFISEDELDKLIDYVEKFQYNKR Homology
BLAST of Cla97C08G159420 vs. NCBI nr
Match: KGN62525.1 (hypothetical protein Csa_022453 [Cucumis sativus]) HSP 1 Score: 158.7 bits (400), Expect = 2.3e-35 Identity = 76/87 (87.36%), Postives = 79/87 (90.80%), Query Frame = 0
BLAST of Cla97C08G159420 vs. NCBI nr
Match: KAA0060886.1 (putative calcium-binding protein CML10 [Cucumis melo var. makuwa]) HSP 1 Score: 156.0 bits (393), Expect = 1.5e-34 Identity = 74/81 (91.36%), Postives = 76/81 (93.83%), Query Frame = 0
BLAST of Cla97C08G159420 vs. NCBI nr
Match: KAA0060892.1 (putative calcium-binding protein CML10 [Cucumis melo var. makuwa]) HSP 1 Score: 131.0 bits (328), Expect = 5.1e-27 Identity = 57/81 (70.37%), Postives = 71/81 (87.65%), Query Frame = 0
BLAST of Cla97C08G159420 vs. NCBI nr
Match: XP_004152805.1 (probable calcium-binding protein CML10 [Cucumis sativus]) HSP 1 Score: 124.0 bits (310), Expect = 6.3e-25 Identity = 53/81 (65.43%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of Cla97C08G159420 vs. NCBI nr
Match: KGN62516.1 (hypothetical protein Csa_022521 [Cucumis sativus]) HSP 1 Score: 124.0 bits (310), Expect = 6.3e-25 Identity = 53/81 (65.43%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of Cla97C08G159420 vs. ExPASy Swiss-Prot
Match: Q8RZB5 (Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica OX=39947 GN=CML10 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 8.8e-06 Identity = 31/74 (41.89%), Postives = 40/74 (54.05%), Query Frame = 0
BLAST of Cla97C08G159420 vs. ExPASy Swiss-Prot
Match: Q5ZD81 (Probable calcium-binding protein CML12 OS=Oryza sativa subsp. japonica OX=39947 GN=CML12 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 5.7e-05 Identity = 23/62 (37.10%), Postives = 38/62 (61.29%), Query Frame = 0
BLAST of Cla97C08G159420 vs. ExPASy Swiss-Prot
Match: Q8X187 (Calmodulin OS=Paxillus involutus OX=71150 GN=calA PE=2 SV=3) HSP 1 Score: 46.6 bits (109), Expect = 1.7e-04 Identity = 25/65 (38.46%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of Cla97C08G159420 vs. ExPASy Swiss-Prot
Match: Q9FYK2 (Probable calcium-binding protein CML25 OS=Arabidopsis thaliana OX=3702 GN=CML25 PE=2 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 2.2e-04 Identity = 21/61 (34.43%), Postives = 36/61 (59.02%), Query Frame = 0
BLAST of Cla97C08G159420 vs. ExPASy Swiss-Prot
Match: O64943 (Polcalcin Jun o 2 OS=Juniperus oxycedrus OX=69008 PE=1 SV=2) HSP 1 Score: 46.2 bits (108), Expect = 2.2e-04 Identity = 24/70 (34.29%), Postives = 39/70 (55.71%), Query Frame = 0
BLAST of Cla97C08G159420 vs. ExPASy TrEMBL
Match: A0A0A0LKX1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G359940 PE=4 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 1.1e-35 Identity = 76/87 (87.36%), Postives = 79/87 (90.80%), Query Frame = 0
BLAST of Cla97C08G159420 vs. ExPASy TrEMBL
Match: A0A5A7V2Z9 (Putative calcium-binding protein CML10 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold501G00190 PE=4 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 7.2e-35 Identity = 74/81 (91.36%), Postives = 76/81 (93.83%), Query Frame = 0
BLAST of Cla97C08G159420 vs. ExPASy TrEMBL
Match: A0A5A7UYC0 (Putative calcium-binding protein CML10 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold501G00250 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.5e-27 Identity = 57/81 (70.37%), Postives = 71/81 (87.65%), Query Frame = 0
BLAST of Cla97C08G159420 vs. ExPASy TrEMBL
Match: A0A0A0LRC1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G358870 PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 3.0e-25 Identity = 53/81 (65.43%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of Cla97C08G159420 vs. ExPASy TrEMBL
Match: A0A6J1CSH1 (probable calcium-binding protein CML15 OS=Momordica charantia OX=3673 GN=LOC111013915 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 1.1e-22 Identity = 52/74 (70.27%), Postives = 63/74 (85.14%), Query Frame = 0
BLAST of Cla97C08G159420 vs. TAIR 10
Match: AT1G24620.1 (EF hand calcium-binding protein family ) HSP 1 Score: 46.2 bits (108), Expect = 1.5e-05 Identity = 21/61 (34.43%), Postives = 36/61 (59.02%), Query Frame = 0
BLAST of Cla97C08G159420 vs. TAIR 10
Match: AT3G03000.1 (EF hand calcium-binding protein family ) HSP 1 Score: 45.4 bits (106), Expect = 2.6e-05 Identity = 23/69 (33.33%), Postives = 40/69 (57.97%), Query Frame = 0
BLAST of Cla97C08G159420 vs. TAIR 10
Match: AT3G51920.1 (calmodulin 9 ) HSP 1 Score: 45.4 bits (106), Expect = 2.6e-05 Identity = 24/63 (38.10%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of Cla97C08G159420 vs. TAIR 10
Match: AT1G18530.1 (EF hand calcium-binding protein family ) HSP 1 Score: 45.1 bits (105), Expect = 3.4e-05 Identity = 22/63 (34.92%), Postives = 37/63 (58.73%), Query Frame = 0
BLAST of Cla97C08G159420 vs. TAIR 10
Match: AT1G32250.1 (Calcium-binding EF-hand family protein ) HSP 1 Score: 44.7 bits (104), Expect = 4.5e-05 Identity = 21/67 (31.34%), Postives = 40/67 (59.70%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (97103) v2.5
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|