ClCG08G003930 (gene) Watermelon (Charleston Gray) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGAAACAAAATTCTCTGTAATCGCCGTCGTAGCGGTGGCTTTGGTGGCGGCGGGCGTGGTGGTGGAAGGATACGGCGGAAGAGTAGGCGGAAGAATGGAGATCAAAGACGTGAAGAGGAACGAAGAAGTGCAGCGATTAGGAAGATTCAGTGTGGAGGAGTATAATCGGATGGCAGGCGGCCGTGGCAGTGGCGGAGGAGAGGTGAAGTTCGCGGCGGTGGTTGCGGCGGAGAGACAGGTGGTGTCGGGGACGAAGTACTATTTGAGAATTTTGGGGATTCAAAATGGTGAGAGGAAGATTTTTGATTCGGTTGTAATGGTGAAGCCGTGGATTGGTTCTAAGCGCCTCCTGGATTTTTCGCCTTCCAGAGTTTTAAGCACTCCAATTTTTAATTTCTGA ATGGCGGAAACAAAATTCTCTGTAATCGCCGTCGTAGCGGTGGCTTTGGTGGCGGCGGGCGTGGTGGTGGAAGGATACGGCGGAAGAGTAGGCGGAAGAATGGAGATCAAAGACGTGAAGAGGAACGAAGAAGTGCAGCGATTAGGAAGATTCAGTGTGGAGGAGTATAATCGGATGGCAGGCGGCCGTGGCAGTGGCGGAGGAGAGGTGAAGTTCGCGGCGGTGGTTGCGGCGGAGAGACAGGTGGTGTCGGGGACGAAGTACTATTTGAGAATTTTGGGGATTCAAAATGGTGAGAGGAAGATTTTTGATTCGGTTGTAATGGTGAAGCCGTGGATTGGTTCTAAGCGCCTCCTGGATTTTTCGCCTTCCAGAGTTTTAAGCACTCCAATTTTTAATTTCTGA ATGGCGGAAACAAAATTCTCTGTAATCGCCGTCGTAGCGGTGGCTTTGGTGGCGGCGGGCGTGGTGGTGGAAGGATACGGCGGAAGAGTAGGCGGAAGAATGGAGATCAAAGACGTGAAGAGGAACGAAGAAGTGCAGCGATTAGGAAGATTCAGTGTGGAGGAGTATAATCGGATGGCAGGCGGCCGTGGCAGTGGCGGAGGAGAGGTGAAGTTCGCGGCGGTGGTTGCGGCGGAGAGACAGGTGGTGTCGGGGACGAAGTACTATTTGAGAATTTTGGGGATTCAAAATGGTGAGAGGAAGATTTTTGATTCGGTTGTAATGGTGAAGCCGTGGATTGGTTCTAAGCGCCTCCTGGATTTTTCGCCTTCCAGAGTTTTAAGCACTCCAATTTTTAATTTCTGA MAETKFSVIAVVAVALVAAGVVVEGYGGRVGGRMEIKDVKRNEEVQRLGRFSVEEYNRMAGGRGSGGGEVKFAAVVAAERQVVSGTKYYLRILGIQNGERKIFDSVVMVKPWIGSKRLLDFSPSRVLSTPIFNF Homology
BLAST of ClCG08G003930 vs. NCBI nr
Match: XP_038886316.1 (cysteine proteinase inhibitor 4 [Benincasa hispida]) HSP 1 Score: 211.8 bits (538), Expect = 3.5e-51 Identity = 114/134 (85.07%), Postives = 119/134 (88.81%), Query Frame = 0
BLAST of ClCG08G003930 vs. NCBI nr
Match: XP_004138536.1 (cysteine proteinase inhibitor B [Cucumis sativus] >KGN45922.1 hypothetical protein Csa_005586 [Cucumis sativus]) HSP 1 Score: 201.8 bits (512), Expect = 3.6e-48 Identity = 111/135 (82.22%), Postives = 118/135 (87.41%), Query Frame = 0
BLAST of ClCG08G003930 vs. NCBI nr
Match: XP_008465470.1 (PREDICTED: cysteine proteinase inhibitor B [Cucumis melo]) HSP 1 Score: 196.8 bits (499), Expect = 1.2e-46 Identity = 109/134 (81.34%), Postives = 114/134 (85.07%), Query Frame = 0
BLAST of ClCG08G003930 vs. NCBI nr
Match: XP_022960190.1 (cysteine proteinase inhibitor B [Cucurbita moschata]) HSP 1 Score: 169.1 bits (427), Expect = 2.6e-38 Identity = 87/134 (64.93%), Postives = 109/134 (81.34%), Query Frame = 0
BLAST of ClCG08G003930 vs. NCBI nr
Match: XP_023005096.1 (cysteine proteinase inhibitor B-like [Cucurbita maxima]) HSP 1 Score: 167.5 bits (423), Expect = 7.6e-38 Identity = 86/134 (64.18%), Postives = 110/134 (82.09%), Query Frame = 0
BLAST of ClCG08G003930 vs. ExPASy Swiss-Prot
Match: Q5N806 (Cysteine proteinase inhibitor 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0915200 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 4.7e-22 Identity = 64/137 (46.72%), Postives = 84/137 (61.31%), Query Frame = 0
BLAST of ClCG08G003930 vs. ExPASy Swiss-Prot
Match: Q10993 (Cysteine proteinase inhibitor B OS=Helianthus annuus OX=4232 PE=1 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.5e-20 Identity = 49/97 (50.52%), Postives = 74/97 (76.29%), Query Frame = 0
BLAST of ClCG08G003930 vs. ExPASy Swiss-Prot
Match: Q0JGM8 (Cysteine proteinase inhibitor 5 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0915401 PE=3 SV=2) HSP 1 Score: 93.6 bits (231), Expect = 1.8e-18 Identity = 50/103 (48.54%), Postives = 68/103 (66.02%), Query Frame = 0
BLAST of ClCG08G003930 vs. ExPASy Swiss-Prot
Match: A2XS65 (Cysteine proteinase inhibitor 10 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_014908 PE=3 SV=2) HSP 1 Score: 86.7 bits (213), Expect = 2.2e-16 Identity = 50/109 (45.87%), Postives = 68/109 (62.39%), Query Frame = 0
BLAST of ClCG08G003930 vs. ExPASy Swiss-Prot
Match: P0C579 (Cysteine proteinase inhibitor 10 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0350100 PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 2.2e-16 Identity = 50/109 (45.87%), Postives = 68/109 (62.39%), Query Frame = 0
BLAST of ClCG08G003930 vs. ExPASy TrEMBL
Match: A0A0A0KC20 (Cystatin OS=Cucumis sativus OX=3659 GN=Csa_6G022340 PE=4 SV=1) HSP 1 Score: 201.8 bits (512), Expect = 1.8e-48 Identity = 111/135 (82.22%), Postives = 118/135 (87.41%), Query Frame = 0
BLAST of ClCG08G003930 vs. ExPASy TrEMBL
Match: A0A1S3CPD1 (cysteine proteinase inhibitor B OS=Cucumis melo OX=3656 GN=LOC103503076 PE=4 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 5.7e-47 Identity = 109/134 (81.34%), Postives = 114/134 (85.07%), Query Frame = 0
BLAST of ClCG08G003930 vs. ExPASy TrEMBL
Match: A0A6J1H8E3 (cysteine proteinase inhibitor B OS=Cucurbita moschata OX=3662 GN=LOC111461002 PE=4 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 1.3e-38 Identity = 87/134 (64.93%), Postives = 109/134 (81.34%), Query Frame = 0
BLAST of ClCG08G003930 vs. ExPASy TrEMBL
Match: A0A6J1KTZ7 (cysteine proteinase inhibitor B-like OS=Cucurbita maxima OX=3661 GN=LOC111498186 PE=4 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 3.7e-38 Identity = 86/134 (64.18%), Postives = 110/134 (82.09%), Query Frame = 0
BLAST of ClCG08G003930 vs. ExPASy TrEMBL
Match: A0A5A7VC11 (Cysteine proteinase inhibitor B OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold1312G00040 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 8.2e-38 Identity = 87/101 (86.14%), Postives = 89/101 (88.12%), Query Frame = 0
BLAST of ClCG08G003930 vs. TAIR 10
Match: AT2G31980.1 (PHYTOCYSTATIN 2 ) HSP 1 Score: 84.3 bits (207), Expect = 7.9e-17 Identity = 43/106 (40.57%), Postives = 70/106 (66.04%), Query Frame = 0
BLAST of ClCG08G003930 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 65.1 bits (157), Expect = 5.0e-11 Identity = 33/95 (34.74%), Postives = 60/95 (63.16%), Query Frame = 0
BLAST of ClCG08G003930 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 65.1 bits (157), Expect = 5.0e-11 Identity = 33/95 (34.74%), Postives = 60/95 (63.16%), Query Frame = 0
BLAST of ClCG08G003930 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 57.4 bits (137), Expect = 1.0e-08 Identity = 29/95 (30.53%), Postives = 55/95 (57.89%), Query Frame = 0
BLAST of ClCG08G003930 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 55.8 bits (133), Expect = 3.0e-08 Identity = 37/97 (38.14%), Postives = 54/97 (55.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (Charleston Gray) v2.5
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|