Chy5G099610 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CCATTGCTGCAACCACCAGAGAGAATCTCTTATCACCACATGGAGGCACAGGCAACCGCCCCCGTCACACCATGGCATTCGCCCTTACCGTACTTATTCGGTGCCCTTGCTGCCGTTTGTATTCTTATCTCTTTTTCTCTATTGATCCTTGGCTGTTCCTATTGCCGGAAGGTTTCTGTTTCTATATTGAACGGCAACCACGGTGCTGCTCGAGATGCTGACATGGAGTCTGGTCGGGGCAAAGGCGACGGTGATCTGAATCCACTACCATGCGCCATGTTTAACGACAAGGTCTTGGTTATAATGGCTGGACAAGTTAACCCAAGTTTTATAGCTACTCCCATGTCGATGGGTTGTCGTGAAAAGGGACATGACGGGTTGTCCTGA CCATTGCTGCAACCACCAGAGAGAATCTCTTATCACCACATGGAGGCACAGGCAACCGCCCCCGTCACACCATGGCATTCGCCCTTACCGTACTTATTCGGTGCCCTTGCTGCCGTTTGTATTCTTATCTCTTTTTCTCTATTGATCCTTGGCTGTTCCTATTGCCGGAAGGTTTCTGTTTCTATATTGAACGGCAACCACGGTGCTGCTCGAGATGCTGACATGGAGTCTGGTCGGGGCAAAGGCGACGGTGATCTGAATCCACTACCATGCGCCATGTTTAACGACAAGGTCTTGGTTATAATGGCTGGACAAGTTAACCCAAGTTTTATAGCTACTCCCATGTCGATGGGTTGTCGTGAAAAGGGACATGACGGGTTGTCCTGA CCATTGCTGCAACCACCAGAGAGAATCTCTTATCACCACATGGAGGCACAGGCAACCGCCCCCGTCACACCATGGCATTCGCCCTTACCGTACTTATTCGGTGCCCTTGCTGCCGTTTGTATTCTTATCTCTTTTTCTCTATTGATCCTTGGCTGTTCCTATTGCCGGAAGGTTTCTGTTTCTATATTGAACGGCAACCACGGTGCTGCTCGAGATGCTGACATGGAGTCTGGTCGGGGCAAAGGCGACGGTGATCTGAATCCACTACCATGCGCCATGTTTAACGACAAGGTCTTGGTTATAATGGCTGGACAAGTTAACCCAAGTTTTATAGCTACTCCCATGTCGATGGGTTGTCGTGAAAAGGGACATGACGGGTTGTCCTGA PLLQPPERISYHHMEAQATAPVTPWHSPLPYLFGALAAVCILISFSLLILGCSYCRKVSVSILNGNHGAARDADMESGRGKGDGDLNPLPCAMFNDKVLVIMAGQVNPSFIATPMSMGCREKGHDGLS* Homology
BLAST of Chy5G099610 vs. ExPASy Swiss-Prot
Match: Q9FHH5 (Protein GLUTAMINE DUMPER 3 OS=Arabidopsis thaliana OX=3702 GN=GDU3 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 2.0e-14 Identity = 48/115 (41.74%), Postives = 63/115 (54.78%), Query Frame = 0
BLAST of Chy5G099610 vs. ExPASy Swiss-Prot
Match: O81775 (Protein GLUTAMINE DUMPER 1 OS=Arabidopsis thaliana OX=3702 GN=GDU1 PE=1 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 3.4e-14 Identity = 49/115 (42.61%), Postives = 63/115 (54.78%), Query Frame = 0
BLAST of Chy5G099610 vs. ExPASy Swiss-Prot
Match: Q8S8A0 (Protein GLUTAMINE DUMPER 4 OS=Arabidopsis thaliana OX=3702 GN=GDU4 PE=2 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 4.5e-14 Identity = 49/106 (46.23%), Postives = 62/106 (58.49%), Query Frame = 0
BLAST of Chy5G099610 vs. ExPASy Swiss-Prot
Match: Q9SW07 (Protein GLUTAMINE DUMPER 2 OS=Arabidopsis thaliana OX=3702 GN=GDU2 PE=2 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 6.5e-13 Identity = 45/95 (47.37%), Postives = 58/95 (61.05%), Query Frame = 0
BLAST of Chy5G099610 vs. ExPASy Swiss-Prot
Match: Q3E965 (Protein GLUTAMINE DUMPER 5 OS=Arabidopsis thaliana OX=3702 GN=GDU5 PE=2 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 6.1e-11 Identity = 39/94 (41.49%), Postives = 56/94 (59.57%), Query Frame = 0
BLAST of Chy5G099610 vs. ExPASy TrEMBL
Match: A0A5A7UM11 (Protein GLUTAMINE DUMPER 1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold717G00070 PE=3 SV=1) HSP 1 Score: 224.2 bits (570), Expect = 3.2e-55 Identity = 108/115 (93.91%), Postives = 111/115 (96.52%), Query Frame = 0
BLAST of Chy5G099610 vs. ExPASy TrEMBL
Match: A0A1S3CDN6 (protein GLUTAMINE DUMPER 1-like OS=Cucumis melo OX=3656 GN=LOC103499225 PE=3 SV=1) HSP 1 Score: 224.2 bits (570), Expect = 3.2e-55 Identity = 108/115 (93.91%), Postives = 111/115 (96.52%), Query Frame = 0
BLAST of Chy5G099610 vs. ExPASy TrEMBL
Match: A0A0A0LMC7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G058100 PE=3 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 9.0e-50 Identity = 100/105 (95.24%), Postives = 102/105 (97.14%), Query Frame = 0
BLAST of Chy5G099610 vs. ExPASy TrEMBL
Match: A0A6J1DH65 (protein GLUTAMINE DUMPER 3-like OS=Momordica charantia OX=3673 GN=LOC111020847 PE=3 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 1.8e-26 Identity = 69/116 (59.48%), Postives = 83/116 (71.55%), Query Frame = 0
BLAST of Chy5G099610 vs. ExPASy TrEMBL
Match: A0A6J1FDQ8 (protein GLUTAMINE DUMPER 2-like OS=Cucurbita moschata OX=3662 GN=LOC111444458 PE=3 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 5.3e-26 Identity = 63/102 (61.76%), Postives = 76/102 (74.51%), Query Frame = 0
BLAST of Chy5G099610 vs. NCBI nr
Match: XP_008460400.1 (PREDICTED: protein GLUTAMINE DUMPER 1-like [Cucumis melo] >KAA0055617.1 protein GLUTAMINE DUMPER 1-like [Cucumis melo var. makuwa] >TYK24452.1 protein GLUTAMINE DUMPER 1-like [Cucumis melo var. makuwa]) HSP 1 Score: 220 bits (560), Expect = 8.95e-72 Identity = 108/115 (93.91%), Postives = 111/115 (96.52%), Query Frame = 0
BLAST of Chy5G099610 vs. NCBI nr
Match: XP_038891043.1 (protein GLUTAMINE DUMPER 1-like [Benincasa hispida]) HSP 1 Score: 162 bits (411), Expect = 7.82e-49 Identity = 85/113 (75.22%), Postives = 93/113 (82.30%), Query Frame = 0
BLAST of Chy5G099610 vs. NCBI nr
Match: XP_023537956.1 (protein GLUTAMINE DUMPER 5-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 132 bits (332), Expect = 1.42e-36 Identity = 67/102 (65.69%), Postives = 80/102 (78.43%), Query Frame = 0
BLAST of Chy5G099610 vs. NCBI nr
Match: XP_022153323.1 (protein GLUTAMINE DUMPER 3-like [Momordica charantia]) HSP 1 Score: 125 bits (314), Expect = 4.76e-34 Identity = 72/119 (60.50%), Postives = 85/119 (71.43%), Query Frame = 0
BLAST of Chy5G099610 vs. NCBI nr
Match: KAG6586067.1 (Protein GLUTAMINE DUMPER 3, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 124 bits (311), Expect = 2.17e-33 Identity = 66/113 (58.41%), Postives = 79/113 (69.91%), Query Frame = 0
BLAST of Chy5G099610 vs. TAIR 10
Match: AT5G57685.1 (glutamine dumper 3 ) HSP 1 Score: 80.1 bits (196), Expect = 1.4e-15 Identity = 48/115 (41.74%), Postives = 63/115 (54.78%), Query Frame = 0
BLAST of Chy5G099610 vs. TAIR 10
Match: AT4G31730.1 (glutamine dumper 1 ) HSP 1 Score: 79.3 bits (194), Expect = 2.4e-15 Identity = 49/115 (42.61%), Postives = 63/115 (54.78%), Query Frame = 0
BLAST of Chy5G099610 vs. TAIR 10
Match: AT2G24762.1 (glutamine dumper 4 ) HSP 1 Score: 79.0 bits (193), Expect = 3.2e-15 Identity = 49/106 (46.23%), Postives = 62/106 (58.49%), Query Frame = 0
BLAST of Chy5G099610 vs. TAIR 10
Match: AT4G25760.1 (glutamine dumper 2 ) HSP 1 Score: 75.1 bits (183), Expect = 4.6e-14 Identity = 45/95 (47.37%), Postives = 58/95 (61.05%), Query Frame = 0
BLAST of Chy5G099610 vs. TAIR 10
Match: AT5G24920.1 (glutamine dumper 5 ) HSP 1 Score: 68.6 bits (166), Expect = 4.3e-12 Identity = 39/94 (41.49%), Postives = 56/94 (59.57%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|