Carg19561 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.CCTAGATCCGAGACCTTATCTCAAACCTTGATCATGGCGATTGCTCGAACAGGAGTCTACGTCGATGACTATTTGGAATGTATGTAGTATGTTTTCTTTTTGCTTCCACTTTTTCCCTCCTCCTTGTATTCTCTAATCTGCTTCTGCTTTTGTTTCGTTTCAATCTTTGTAGATGCCAGCACATTGCCTGCTGAGCTTCAGAGGCTACTCAACACAATTAGAGAACTCGACGATCGATCTCAGTGTAAAAAATTCGTTTTCTGATTTGATCCACTGTTTAGATCGTCTGTGCTCGGATTCGTTAGTCTGAATTTTTCCTTTTGTTTTGCGTTTTTGTGTTGTATTTGGTTGTAGCGATGATTGATCAGACGAGGCAGCAAACGAAATACTGTCTTGGATTGTCGACACAGAGTTTGAAGAAAGGAATTAATAATAGTAATTCTGAGGATGAGGAGACCGCCTTTGAAAAATTGCGGAAGGATATTGAGGCGAATCAGGATAACGCATTGAGTTTGTGCACTGAGAAGGTTTTGTTGGCACGTCAAGCTGGCGACCTGGTATGGCATACTTAG CCTAGATCCGAGACCTTATCTCAAACCTTGATCATGGCGATTGCTCGAACAGGAGTCTACGTCGATGACTATTTGGAATATGCCAGCACATTGCCTGCTGAGCTTCAGAGGCTACTCAACACAATTAGAGAACTCGACGATCGATCTCAGTCGATGATTGATCAGACGAGGCAGCAAACGAAATACTGTCTTGGATTGTCGACACAGAGTTTGAAGAAAGGAATTAATAATAGTAATTCTGAGGATGAGGAGACCGCCTTTGAAAAATTGCGGAAGGATATTGAGGCGAATCAGGATAACGCATTGAGTTTGTGCACTGAGAAGGTTTTGTTGGCACGTCAAGCTGGCGACCTGGTATGGCATACTTAG CCTAGATCCGAGACCTTATCTCAAACCTTGATCATGGCGATTGCTCGAACAGGAGTCTACGTCGATGACTATTTGGAATATGCCAGCACATTGCCTGCTGAGCTTCAGAGGCTACTCAACACAATTAGAGAACTCGACGATCGATCTCAGTCGATGATTGATCAGACGAGGCAGCAAACGAAATACTGTCTTGGATTGTCGACACAGAGTTTGAAGAAAGGAATTAATAATAGTAATTCTGAGGATGAGGAGACCGCCTTTGAAAAATTGCGGAAGGATATTGAGGCGAATCAGGATAACGCATTGAGTTTGTGCACTGAGAAGGTTTTGTTGGCACGTCAAGCTGGCGACCTGGTATGGCATACTTAG PRSETLSQTLIMAIARTGVYVDDYLEYASTLPAELQRLLNTIRELDDRSQSMIDQTRQQTKYCLGLSTQSLKKGINNSNSEDEETAFEKLRKDIEANQDNALSLCTEKVLLARQAGDLVWHT Homology
BLAST of Carg19561 vs. NCBI nr
Match: KAG7033673.1 (PHD finger protein ING2, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 237.7 bits (605), Expect = 5.5e-59 Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = 0
BLAST of Carg19561 vs. NCBI nr
Match: XP_022949615.1 (PHD finger protein ING2-like [Cucurbita moschata] >KAG6603493.1 PHD finger protein ING2, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 207.2 bits (526), Expect = 7.9e-50 Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = 0
BLAST of Carg19561 vs. NCBI nr
Match: XP_023543183.1 (PHD finger protein ING2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 206.1 bits (523), Expect = 1.8e-49 Identity = 106/108 (98.15%), Postives = 108/108 (100.00%), Query Frame = 0
BLAST of Carg19561 vs. NCBI nr
Match: XP_022978265.1 (PHD finger protein ING2-like [Cucurbita maxima]) HSP 1 Score: 203.8 bits (517), Expect = 8.7e-49 Identity = 105/108 (97.22%), Postives = 107/108 (99.07%), Query Frame = 0
BLAST of Carg19561 vs. NCBI nr
Match: KAA0060114.1 (PHD finger protein ING2 [Cucumis melo var. makuwa] >TYK08428.1 PHD finger protein ING2 [Cucumis melo var. makuwa]) HSP 1 Score: 198.0 bits (502), Expect = 4.8e-47 Identity = 102/108 (94.44%), Postives = 105/108 (97.22%), Query Frame = 0
BLAST of Carg19561 vs. ExPASy Swiss-Prot
Match: B3H615 (PHD finger protein ING2 OS=Arabidopsis thaliana OX=3702 GN=ING2 PE=1 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 1.1e-38 Identity = 84/111 (75.68%), Postives = 97/111 (87.39%), Query Frame = 0
BLAST of Carg19561 vs. ExPASy Swiss-Prot
Match: Q54PN9 (Inhibitor of growth protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=dng1 PE=1 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 3.1e-04 Identity = 30/102 (29.41%), Postives = 54/102 (52.94%), Query Frame = 0
BLAST of Carg19561 vs. ExPASy TrEMBL
Match: A0A6J1GD88 (PHD finger protein ING OS=Cucurbita moschata OX=3662 GN=LOC111452955 PE=3 SV=1) HSP 1 Score: 207.2 bits (526), Expect = 3.8e-50 Identity = 107/108 (99.07%), Postives = 108/108 (100.00%), Query Frame = 0
BLAST of Carg19561 vs. ExPASy TrEMBL
Match: A0A6J1IPK9 (PHD finger protein ING OS=Cucurbita maxima OX=3661 GN=LOC111478300 PE=3 SV=1) HSP 1 Score: 203.8 bits (517), Expect = 4.2e-49 Identity = 105/108 (97.22%), Postives = 107/108 (99.07%), Query Frame = 0
BLAST of Carg19561 vs. ExPASy TrEMBL
Match: A0A5A7UYI0 (PHD finger protein ING2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold654G00430 PE=4 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 2.3e-47 Identity = 102/108 (94.44%), Postives = 105/108 (97.22%), Query Frame = 0
BLAST of Carg19561 vs. ExPASy TrEMBL
Match: A0A1S3B596 (PHD finger protein ING OS=Cucumis melo OX=3656 GN=LOC103485975 PE=3 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 2.3e-47 Identity = 102/108 (94.44%), Postives = 105/108 (97.22%), Query Frame = 0
BLAST of Carg19561 vs. ExPASy TrEMBL
Match: A0A0A0KWF6 (PHD finger protein ING OS=Cucumis sativus OX=3659 GN=Csa_4G192170 PE=3 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 5.2e-47 Identity = 101/108 (93.52%), Postives = 105/108 (97.22%), Query Frame = 0
BLAST of Carg19561 vs. TAIR 10
Match: AT1G54390.4 (PHD finger protein-related ) HSP 1 Score: 160.6 bits (405), Expect = 7.9e-40 Identity = 84/111 (75.68%), Postives = 97/111 (87.39%), Query Frame = 0
BLAST of Carg19561 vs. TAIR 10
Match: AT1G54390.1 (PHD finger protein-related ) HSP 1 Score: 160.6 bits (405), Expect = 7.9e-40 Identity = 84/111 (75.68%), Postives = 97/111 (87.39%), Query Frame = 0
BLAST of Carg19561 vs. TAIR 10
Match: AT1G54390.3 (PHD finger protein-related ) HSP 1 Score: 160.6 bits (405), Expect = 7.9e-40 Identity = 84/111 (75.68%), Postives = 97/111 (87.39%), Query Frame = 0
BLAST of Carg19561 vs. TAIR 10
Match: AT1G54390.2 (PHD finger protein-related ) HSP 1 Score: 160.6 bits (405), Expect = 7.9e-40 Identity = 84/111 (75.68%), Postives = 97/111 (87.39%), Query Frame = 0
BLAST of Carg19561 vs. TAIR 10
Match: AT1G54390.5 (PHD finger protein-related ) HSP 1 Score: 89.7 bits (221), Expect = 1.7e-18 Identity = 47/73 (64.38%), Postives = 60/73 (82.19%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|