Carg12320 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCGGCAGAGGCAAGGGAGGGAAGGGCCTTGGAAAAGGTGGTGCAAAGAGGCACCGTAAGGTTTTGAGGGACAACATCCAAGGAATCACGAAGCCGGCGATTCGGCGGTTGGCCAGACGAGGCGGCGTAAAGCGAATCAGTGGCTTGATCTACGAAGAAACTCGCGGCGTTCTTAAGATCTTCCTCGAGAATGTCATCCGCGACGCCGTGACCTACACTGAGCACGCTCGACGGAAGACCGTCACTGCTATGGATGTTGTGTATGCTCTCAAGAGGCAAGGTCGTACTCTCTACGGCTTTGGAGGTTAG ATGTCCGGCAGAGGCAAGGGAGGGAAGGGCCTTGGAAAAGGTGGTGCAAAGAGGCACCGTAAGGTTTTGAGGGACAACATCCAAGGAATCACGAAGCCGGCGATTCGGCGGTTGGCCAGACGAGGCGGCGTAAAGCGAATCAGTGGCTTGATCTACGAAGAAACTCGCGGCGTTCTTAAGATCTTCCTCGAGAATGTCATCCGCGACGCCGTGACCTACACTGAGCACGCTCGACGGAAGACCGTCACTGCTATGGATGTTGTGTATGCTCTCAAGAGGCAAGGTCGTACTCTCTACGGCTTTGGAGGTTAG ATGTCCGGCAGAGGCAAGGGAGGGAAGGGCCTTGGAAAAGGTGGTGCAAAGAGGCACCGTAAGGTTTTGAGGGACAACATCCAAGGAATCACGAAGCCGGCGATTCGGCGGTTGGCCAGACGAGGCGGCGTAAAGCGAATCAGTGGCTTGATCTACGAAGAAACTCGCGGCGTTCTTAAGATCTTCCTCGAGAATGTCATCCGCGACGCCGTGACCTACACTGAGCACGCTCGACGGAAGACCGTCACTGCTATGGATGTTGTGTATGCTCTCAAGAGGCAAGGTCGTACTCTCTACGGCTTTGGAGGTTAG MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG Homology
BLAST of Carg12320 vs. NCBI nr
Match: KAG4994989.1 (hypothetical protein JHK86_031816 [Glycine max] >KAG5124986.1 hypothetical protein JHK82_031723 [Glycine max] >KAG5146415.1 hypothetical protein JHK84_031958 [Glycine max]) HSP 1 Score: 199.5 bits (506), Expect = 1.4e-47 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. NCBI nr
Match: XP_016507811.1 (PREDICTED: uncharacterized protein LOC107825453 [Nicotiana tabacum]) HSP 1 Score: 199.5 bits (506), Expect = 1.4e-47 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. NCBI nr
Match: XP_040955110.1 (uncharacterized protein LOC107932445 [Gossypium hirsutum]) HSP 1 Score: 199.5 bits (506), Expect = 1.4e-47 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. NCBI nr
Match: KAF8369934.1 (hypothetical protein HHK36_032037 [Tetracentron sinense]) HSP 1 Score: 199.5 bits (506), Expect = 1.4e-47 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. NCBI nr
Match: RZC63811.1 (hypothetical protein C5167_025549 [Papaver somniferum]) HSP 1 Score: 199.5 bits (506), Expect = 1.4e-47 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. ExPASy Swiss-Prot
Match: P62785 (Histone H4 variant TH011 OS=Triticum aestivum OX=4565 PE=3 SV=2) HSP 1 Score: 199.5 bits (506), Expect = 1.8e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. ExPASy Swiss-Prot
Match: P59259 (Histone H4 OS=Arabidopsis thaliana OX=3702 GN=At1g07660 PE=1 SV=2) HSP 1 Score: 199.5 bits (506), Expect = 1.8e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. ExPASy Swiss-Prot
Match: Q6PMI5 (Histone H4 OS=Chelidonium majus OX=71251 PE=3 SV=3) HSP 1 Score: 199.5 bits (506), Expect = 1.8e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. ExPASy Swiss-Prot
Match: Q6WZ83 (Histone H4 OS=Eucalyptus globulus OX=34317 PE=3 SV=3) HSP 1 Score: 199.5 bits (506), Expect = 1.8e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. ExPASy Swiss-Prot
Match: Q6LAF3 (Histone H4 OS=Flaveria trinervia OX=4227 GN=hh4 PE=3 SV=3) HSP 1 Score: 199.5 bits (506), Expect = 1.8e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. ExPASy TrEMBL
Match: K3YX00 (Histone H4 OS=Setaria italica OX=4555 GN=101768337 PE=3 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 6.7e-48 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. ExPASy TrEMBL
Match: A0A2G9H387 (Histone H4 OS=Handroanthus impetiginosus OX=429701 GN=CDL12_07454 PE=3 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 6.7e-48 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. ExPASy TrEMBL
Match: A0A7I8LBC1 (Histone H4 OS=Spirodela intermedia OX=51605 GN=SI7747_01001442 PE=3 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 6.7e-48 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. ExPASy TrEMBL
Match: A0A1U7WSH0 (Histone H4 OS=Nicotiana sylvestris OX=4096 GN=LOC104226805 PE=3 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 6.7e-48 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. ExPASy TrEMBL
Match: A0A1U8PD97 (Histone H4 OS=Gossypium hirsutum OX=3635 GN=LOC107957992 PE=3 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 6.7e-48 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. TAIR 10
Match: AT1G07660.1 (Histone superfamily protein ) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-51 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. TAIR 10
Match: AT1G07820.1 (Histone superfamily protein ) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-51 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. TAIR 10
Match: AT1G07820.2 (Histone superfamily protein ) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-51 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. TAIR 10
Match: AT2G28740.1 (histone H4 ) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-51 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg12320 vs. TAIR 10
Match: AT3G45930.1 (Histone superfamily protein ) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-51 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|