CaUC01G000110 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTACCAGTGAACTCGCTTGCACCTACACCGCCTTGATTCTTCATGGCGACGCCATCTCCGTCGCTGTACCTATCAATATTCCTTTTTACCTCCTTCCATTTCTAACAACTCTCTTCTTCTTTCTTTCCATATTTTAATTTAGGCCGAGAAGATTTCCAAGTCGGTGAACGCTGCCGGCCTTACCGTCGAATCCTACTGGCCTTCTCTCTTTTCTCTCTCCATCTCATCTTCTGCCGGTAATGCCGCTCCTGCGCCCGTACTTGCCTAAATAACAAATAATTCAAAATTAGGATTATATAAGTTTATACATGATTTTAGATCGCTGAAAGCAATTGAGCCTATAGCTCCTTCTTACTGGAGCATATATATTATTGATTTTGATTTACGTATATTCCTGGTTATATATGGTTGTATTGTACCTGTATCATATGCAGGAAGAGGTGATGGAAGAGAGCGAGGATGAGATGGTCTTGGGCTTTGTTTGA ATGTCTACCAGTGAACTCGCTTGCACCTACACCGCCTTGATTCTTCATGGCGACGCCATCTCCGTCGCTGCCGAGAAGATTTCCAAGTCGGTGAACGCTGCCGGCCTTACCGTCGAATCCTACTGGCCTTCTCTCTTTTCTCTCTCCATCTCATCTTCTGCCGGTAATGCCGCTCCTGCGCCCGAAGAGGTGATGGAAGAGAGCGAGGATGAGATGGTCTTGGGCTTTGTTTGA ATGTCTACCAGTGAACTCGCTTGCACCTACACCGCCTTGATTCTTCATGGCGACGCCATCTCCGTCGCTGCCGAGAAGATTTCCAAGTCGGTGAACGCTGCCGGCCTTACCGTCGAATCCTACTGGCCTTCTCTCTTTTCTCTCTCCATCTCATCTTCTGCCGGTAATGCCGCTCCTGCGCCCGAAGAGGTGATGGAAGAGAGCGAGGATGAGATGGTCTTGGGCTTTGTTTGA MSTSELACTYTALILHGDAISVAAEKISKSVNAAGLTVESYWPSLFSLSISSSAGNAAPAPEEVMEESEDEMVLGFV Homology
BLAST of CaUC01G000110 vs. NCBI nr
Match: XP_022138164.1 (60S acidic ribosomal protein P1-like isoform X2 [Momordica charantia]) HSP 1 Score: 86.3 bits (212), Expect = 1.3e-13 Identity = 58/109 (53.21%), Postives = 65/109 (59.63%), Query Frame = 0
BLAST of CaUC01G000110 vs. NCBI nr
Match: XP_022138163.1 (60S acidic ribosomal protein P1-like isoform X1 [Momordica charantia]) HSP 1 Score: 79.7 bits (195), Expect = 1.2e-11 Identity = 54/105 (51.43%), Postives = 61/105 (58.10%), Query Frame = 0
BLAST of CaUC01G000110 vs. NCBI nr
Match: XP_006394706.1 (60S acidic ribosomal protein P1 [Eutrema salsugineum] >ESQ31992.1 hypothetical protein EUTSA_v10005602mg [Eutrema salsugineum]) HSP 1 Score: 76.3 bits (186), Expect = 1.3e-10 Identity = 48/107 (44.86%), Postives = 58/107 (54.21%), Query Frame = 0
BLAST of CaUC01G000110 vs. NCBI nr
Match: VDD28308.1 (unnamed protein product [Brassica oleracea]) HSP 1 Score: 74.3 bits (181), Expect = 5.0e-10 Identity = 47/105 (44.76%), Postives = 57/105 (54.29%), Query Frame = 0
BLAST of CaUC01G000110 vs. NCBI nr
Match: XP_013659163.1 (60S acidic ribosomal protein P1 isoform X2 [Brassica napus]) HSP 1 Score: 73.9 bits (180), Expect = 6.6e-10 Identity = 47/106 (44.34%), Postives = 57/106 (53.77%), Query Frame = 0
BLAST of CaUC01G000110 vs. ExPASy Swiss-Prot
Match: P29763 (60S acidic ribosomal protein P1 OS=Chlamydomonas reinhardtii OX=3055 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 5.8e-09 Identity = 33/71 (46.48%), Postives = 43/71 (60.56%), Query Frame = 0
BLAST of CaUC01G000110 vs. ExPASy Swiss-Prot
Match: P52855 (60S acidic ribosomal protein P1 OS=Zea mays OX=4577 GN=RPP1A PE=1 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.7e-08 Identity = 40/98 (40.82%), Postives = 52/98 (53.06%), Query Frame = 0
BLAST of CaUC01G000110 vs. ExPASy Swiss-Prot
Match: P47955 (60S acidic ribosomal protein P1 OS=Mus musculus OX=10090 GN=Rplp1 PE=1 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 3.8e-08 Identity = 39/109 (35.78%), Postives = 55/109 (50.46%), Query Frame = 0
BLAST of CaUC01G000110 vs. ExPASy Swiss-Prot
Match: P18660 (60S acidic ribosomal protein P1 OS=Gallus gallus OX=9031 GN=RPLP1 PE=3 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 6.4e-08 Identity = 38/109 (34.86%), Postives = 54/109 (49.54%), Query Frame = 0
BLAST of CaUC01G000110 vs. ExPASy Swiss-Prot
Match: Q56K14 (60S acidic ribosomal protein P1 OS=Bos taurus OX=9913 GN=RPLP1 PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 8.4e-08 Identity = 29/68 (42.65%), Postives = 43/68 (63.24%), Query Frame = 0
BLAST of CaUC01G000110 vs. ExPASy TrEMBL
Match: A0A6J1C9A3 (60S acidic ribosomal protein P1-like isoform X2 OS=Momordica charantia OX=3673 GN=LOC111009401 PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 6.2e-14 Identity = 58/109 (53.21%), Postives = 65/109 (59.63%), Query Frame = 0
BLAST of CaUC01G000110 vs. ExPASy TrEMBL
Match: A0A6J1CC92 (60S acidic ribosomal protein P1-like isoform X1 OS=Momordica charantia OX=3673 GN=LOC111009401 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 5.8e-12 Identity = 54/105 (51.43%), Postives = 61/105 (58.10%), Query Frame = 0
BLAST of CaUC01G000110 vs. ExPASy TrEMBL
Match: V4KQ04 (Uncharacterized protein OS=Eutrema salsugineum OX=72664 GN=EUTSA_v10005602mg PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 6.4e-11 Identity = 48/107 (44.86%), Postives = 58/107 (54.21%), Query Frame = 0
BLAST of CaUC01G000110 vs. ExPASy TrEMBL
Match: A0A3P6DP70 (Uncharacterized protein OS=Brassica oleracea OX=3712 GN=BOLC9T53631H PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 2.4e-10 Identity = 47/105 (44.76%), Postives = 57/105 (54.29%), Query Frame = 0
BLAST of CaUC01G000110 vs. ExPASy TrEMBL
Match: A0A397XR95 (Uncharacterized protein OS=Brassica campestris OX=3711 GN=BRAA09T36288Z PE=3 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 3.2e-10 Identity = 47/106 (44.34%), Postives = 57/106 (53.77%), Query Frame = 0
BLAST of CaUC01G000110 vs. TAIR 10
Match: AT5G24510.1 (60S acidic ribosomal protein family ) HSP 1 Score: 70.5 bits (171), Expect = 6.8e-13 Identity = 49/108 (45.37%), Postives = 58/108 (53.70%), Query Frame = 0
BLAST of CaUC01G000110 vs. TAIR 10
Match: AT1G01100.3 (60S acidic ribosomal protein family ) HSP 1 Score: 58.9 bits (141), Expect = 2.0e-09 Identity = 36/92 (39.13%), Postives = 54/92 (58.70%), Query Frame = 0
BLAST of CaUC01G000110 vs. TAIR 10
Match: AT5G47700.1 (60S acidic ribosomal protein family ) HSP 1 Score: 53.9 bits (128), Expect = 6.6e-08 Identity = 29/72 (40.28%), Postives = 43/72 (59.72%), Query Frame = 0
BLAST of CaUC01G000110 vs. TAIR 10
Match: AT5G47700.2 (60S acidic ribosomal protein family ) HSP 1 Score: 53.9 bits (128), Expect = 6.6e-08 Identity = 29/72 (40.28%), Postives = 43/72 (59.72%), Query Frame = 0
BLAST of CaUC01G000110 vs. TAIR 10
Match: AT1G01100.1 (60S acidic ribosomal protein family ) HSP 1 Score: 52.4 bits (124), Expect = 1.9e-07 Identity = 28/72 (38.89%), Postives = 43/72 (59.72%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
|