Cp4.1LG04g01190 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGATGATGCAGTGGTGTGGCGCAGTAGCTAGGGGAGTGATGGCGGCGGAGCGCCGGTCGCCTTCACTAACGTCGTCAATGGCGGTGGAAGGACTGGTTCCGATCCTTTGTGGACGAGGTGACAAGAAGACGAAGAAGGGGAAAATATTCAAAGGATCGTACGGCAACGCCAGGCCGAAGAAGGAGAAGAAGATTCAGCGGATCAAGGACAAAATCGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATCTGA ATGGCGATGATGCAGTGGTGTGGCGCAGTAGCTAGGGGAGTGATGGCGGCGGAGCGCCGGTCGCCTTCACTAACGTCGTCAATGGCGGTGGAAGGACTGGTTCCGATCCTTTGTGGACGAGGTGACAAGAAGACGAAGAAGGGGAAAATATTCAAAGGATCGTACGGCAACGCCAGGCCGAAGAAGGAGAAGAAGATTCAGCGGATCAAGGACAAAATCGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATCTGA ATGGCGATGATGCAGTGGTGTGGCGCAGTAGCTAGGGGAGTGATGGCGGCGGAGCGCCGGTCGCCTTCACTAACGTCGTCAATGGCGGTGGAAGGACTGGTTCCGATCCTTTGTGGACGAGGTGACAAGAAGACGAAGAAGGGGAAAATATTCAAAGGATCGTACGGCAACGCCAGGCCGAAGAAGGAGAAGAAGATTCAGCGGATCAAGGACAAAATCGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATCTGA MAMMQWCGAVARGVMAAERRSPSLTSSMAVEGLVPILCGRGDKKTKKGKIFKGSYGNARPKKEKKIQRIKDKIEVPSSTPWPLPFKLI
BLAST of Cp4.1LG04g01190 vs. Swiss-Prot
Match: RT31_ARATH (30S ribosomal protein S31, mitochondrial OS=Arabidopsis thaliana GN=At2g21290 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 4.9e-25 Identity = 59/98 (60.20%), Postives = 68/98 (69.39%), Query Frame = 1
BLAST of Cp4.1LG04g01190 vs. Swiss-Prot
Match: RT31_ORYSJ (30S ribosomal protein S31, mitochondrial OS=Oryza sativa subsp. japonica GN=Os09g0528100 PE=3 SV=2) HSP 1 Score: 98.6 bits (244), Expect = 3.6e-20 Identity = 44/53 (83.02%), Postives = 50/53 (94.34%), Query Frame = 1
BLAST of Cp4.1LG04g01190 vs. TrEMBL
Match: A0A0A0K141_CUCSA (30S ribosomal protein S31, mitochondrial OS=Cucumis sativus GN=Csa_7G006280 PE=4 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 3.5e-38 Identity = 83/88 (94.32%), Postives = 85/88 (96.59%), Query Frame = 1
BLAST of Cp4.1LG04g01190 vs. TrEMBL
Match: A5AQK5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_029514 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 2.1e-27 Identity = 64/88 (72.73%), Postives = 70/88 (79.55%), Query Frame = 1
BLAST of Cp4.1LG04g01190 vs. TrEMBL
Match: F6I185_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_03s0038g00730 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 2.1e-27 Identity = 64/88 (72.73%), Postives = 70/88 (79.55%), Query Frame = 1
BLAST of Cp4.1LG04g01190 vs. TrEMBL
Match: M5VXZ0_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa013856mg PE=4 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 3.6e-27 Identity = 67/99 (67.68%), Postives = 74/99 (74.75%), Query Frame = 1
BLAST of Cp4.1LG04g01190 vs. TrEMBL
Match: A0A061DYK3_THECC (30S ribosomal protein S31 OS=Theobroma cacao GN=TCM_006777 PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 3.1e-26 Identity = 64/88 (72.73%), Postives = 69/88 (78.41%), Query Frame = 1
BLAST of Cp4.1LG04g01190 vs. TAIR10
Match: AT2G21290.1 (AT2G21290.1 unknown protein) HSP 1 Score: 114.8 bits (286), Expect = 2.7e-26 Identity = 59/98 (60.20%), Postives = 68/98 (69.39%), Query Frame = 1
BLAST of Cp4.1LG04g01190 vs. NCBI nr
Match: gi|659094414|ref|XP_008448047.1| (PREDICTED: 30S ribosomal protein S31, mitochondrial [Cucumis melo]) HSP 1 Score: 166.0 bits (419), Expect = 2.9e-38 Identity = 82/88 (93.18%), Postives = 85/88 (96.59%), Query Frame = 1
BLAST of Cp4.1LG04g01190 vs. NCBI nr
Match: gi|778722736|ref|XP_011658557.1| (PREDICTED: 30S ribosomal protein S31, mitochondrial [Cucumis sativus]) HSP 1 Score: 165.2 bits (417), Expect = 5.0e-38 Identity = 83/88 (94.32%), Postives = 85/88 (96.59%), Query Frame = 1
BLAST of Cp4.1LG04g01190 vs. NCBI nr
Match: gi|147775816|emb|CAN75923.1| (hypothetical protein VITISV_029514 [Vitis vinifera]) HSP 1 Score: 129.4 bits (324), Expect = 3.1e-27 Identity = 64/88 (72.73%), Postives = 70/88 (79.55%), Query Frame = 1
BLAST of Cp4.1LG04g01190 vs. NCBI nr
Match: gi|645262601|ref|XP_008236836.1| (PREDICTED: 30S ribosomal protein S31, mitochondrial [Prunus mume]) HSP 1 Score: 129.4 bits (324), Expect = 3.1e-27 Identity = 67/99 (67.68%), Postives = 75/99 (75.76%), Query Frame = 1
BLAST of Cp4.1LG04g01190 vs. NCBI nr
Match: gi|225427776|ref|XP_002268532.1| (PREDICTED: 30S ribosomal protein S31, mitochondrial [Vitis vinifera]) HSP 1 Score: 129.4 bits (324), Expect = 3.1e-27 Identity = 64/88 (72.73%), Postives = 70/88 (79.55%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|