Carg22932 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGATGATGCAGTGGTGTGGCGCGGTAGCTAGGGGAGTGATGGCGGCGGAGCGCCGGTCGCCTTCACTAACGTCGTCAATGGCGGTGGAAGGACTGGTTCCGATCCTTTGTGGACGAGGTGACAAGAAGACGAAGAAGGGGAAAATATTCAAAGGCTCGTACGGCAACGCCAGGCCGAAGAAGGAGAAGAAGATTCAGCGGATCAAGGACAAAATCGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATCTGA ATGGCGATGATGCAGTGGTGTGGCGCGGTAGCTAGGGGAGTGATGGCGGCGGAGCGCCGGTCGCCTTCACTAACGTCGTCAATGGCGGTGGAAGGACTGGTTCCGATCCTTTGTGGACGAGGTGACAAGAAGACGAAGAAGGGGAAAATATTCAAAGGCTCGTACGGCAACGCCAGGCCGAAGAAGGAGAAGAAGATTCAGCGGATCAAGGACAAAATCGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATCTGA ATGGCGATGATGCAGTGGTGTGGCGCGGTAGCTAGGGGAGTGATGGCGGCGGAGCGCCGGTCGCCTTCACTAACGTCGTCAATGGCGGTGGAAGGACTGGTTCCGATCCTTTGTGGACGAGGTGACAAGAAGACGAAGAAGGGGAAAATATTCAAAGGCTCGTACGGCAACGCCAGGCCGAAGAAGGAGAAGAAGATTCAGCGGATCAAGGACAAAATCGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATCTGA MAMMQWCGAVARGVMAAERRSPSLTSSMAVEGLVPILCGRGDKKTKKGKIFKGSYGNARPKKEKKIQRIKDKIEVPSSTPWPLPFKLI
BLAST of Carg22932 vs. NCBI nr
Match: XP_022933003.1 (30S ribosomal protein S31, mitochondrial [Cucurbita moschata] >XP_023529502.1 30S ribosomal protein S31, mitochondrial isoform X1 [Cucurbita pepo subsp. pepo] >XP_023529503.1 30S ribosomal protein S31, mitochondrial isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 176.8 bits (447), Expect = 3.2e-41 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of Carg22932 vs. NCBI nr
Match: XP_022971575.1 (30S ribosomal protein S31, mitochondrial [Cucurbita maxima]) HSP 1 Score: 169.9 bits (429), Expect = 4.0e-39 Identity = 84/86 (97.67%), Postives = 85/86 (98.84%), Query Frame = 0
BLAST of Carg22932 vs. NCBI nr
Match: XP_008448047.1 (PREDICTED: 30S ribosomal protein S31, mitochondrial [Cucumis melo]) HSP 1 Score: 166.0 bits (419), Expect = 5.7e-38 Identity = 82/88 (93.18%), Postives = 85/88 (96.59%), Query Frame = 0
BLAST of Carg22932 vs. NCBI nr
Match: XP_022952601.1 (30S ribosomal protein S31, mitochondrial-like [Cucurbita moschata]) HSP 1 Score: 166.0 bits (419), Expect = 5.7e-38 Identity = 82/86 (95.35%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Carg22932 vs. NCBI nr
Match: XP_011658557.1 (PREDICTED: 30S ribosomal protein S31, mitochondrial [Cucumis sativus] >KGN43178.1 30S ribosomal protein S31, mitochondrial [Cucumis sativus]) HSP 1 Score: 165.2 bits (417), Expect = 9.8e-38 Identity = 83/88 (94.32%), Postives = 85/88 (96.59%), Query Frame = 0
BLAST of Carg22932 vs. TAIR10
Match: AT2G21290.1 (unknown protein) HSP 1 Score: 114.8 bits (286), Expect = 2.7e-26 Identity = 59/98 (60.20%), Postives = 68/98 (69.39%), Query Frame = 0
BLAST of Carg22932 vs. TAIR10
Match: AT2G38140.1 (plastid-specific ribosomal protein 4) HSP 1 Score: 41.2 bits (95), Expect = 3.9e-04 Identity = 17/26 (65.38%), Postives = 21/26 (80.77%), Query Frame = 0
BLAST of Carg22932 vs. Swiss-Prot
Match: sp|Q9SJU8|RT31_ARATH (30S ribosomal protein S31, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g21290 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 5.0e-25 Identity = 59/98 (60.20%), Postives = 68/98 (69.39%), Query Frame = 0
BLAST of Carg22932 vs. Swiss-Prot
Match: sp|P47909|RT31_ORYSJ (30S ribosomal protein S31, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=Os09g0528100 PE=3 SV=2) HSP 1 Score: 98.6 bits (244), Expect = 3.7e-20 Identity = 44/53 (83.02%), Postives = 50/53 (94.34%), Query Frame = 0
BLAST of Carg22932 vs. TrEMBL
Match: tr|A0A1S3BI88|A0A1S3BI88_CUCME (30S ribosomal protein S31, mitochondrial OS=Cucumis melo OX=3656 GN=LOC103490344 PE=4 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 3.8e-38 Identity = 82/88 (93.18%), Postives = 85/88 (96.59%), Query Frame = 0
BLAST of Carg22932 vs. TrEMBL
Match: tr|A0A0A0K141|A0A0A0K141_CUCSA (30S ribosomal protein S31, mitochondrial OS=Cucumis sativus OX=3659 GN=Csa_7G006280 PE=4 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 6.5e-38 Identity = 83/88 (94.32%), Postives = 85/88 (96.59%), Query Frame = 0
BLAST of Carg22932 vs. TrEMBL
Match: tr|A0A2N9IYS6|A0A2N9IYS6_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS58369 PE=4 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 1.6e-28 Identity = 69/92 (75.00%), Postives = 75/92 (81.52%), Query Frame = 0
BLAST of Carg22932 vs. TrEMBL
Match: tr|A0A1R3HVM9|A0A1R3HVM9_COCAP (Putative 30S ribosomal protein S31, mitochondrial OS=Corchorus capsularis OX=210143 GN=CCACVL1_16756 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 6.1e-28 Identity = 71/91 (78.02%), Postives = 74/91 (81.32%), Query Frame = 0
BLAST of Carg22932 vs. TrEMBL
Match: tr|A0A1R3HYV5|A0A1R3HYV5_9ROSI (Putative 30S ribosomal protein S31, mitochondrial OS=Corchorus olitorius OX=93759 GN=COLO4_26047 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 6.1e-28 Identity = 71/91 (78.02%), Postives = 74/91 (81.32%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |