Cucsa.240590 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCAATGTCCTCTCATGGCTCAAATGCATGGACTAAAATGCAAAACAAGACATTTGAAATGGCTTTGGCTGAATATGATCAAGACACTCCTGAACGATGGGTGAATGTTGCTAAGGCTGTTGGTGAAAAAACTGAAGAGGAAGTCAAGAGGCATTACCAACTTCTCCTTCATGATGTCAAACATATTGAGTCTGGCAATGTCCCTTTTCCCTATCCAAAGACATCGAGCAATGATGATTTGCCAAGGAAACGAGGTGTCTTGTTTCTCCTTTCTCCTTTCTCGTTTTCAATCTCTCTATGA ATGGCTTCAATGTCCTCTCATGGCTCAAATGCATGGACTAAAATGCAAAACAAGACATTTGAAATGGCTTTGGCTGAATATGATCAAGACACTCCTGAACGATGGGTGAATGTTGCTAAGGCTGTTGGTGAAAAAACTGAAGAGGAAGTCAAGAGGCATTACCAACTTCTCCTTCATGATGTCAAACATATTGAGTCTGGCAATGTCCCTTTTCCCTATCCAAAGACATCGAGCAATGATGATTTGCCAAGGAAACGAGGTGTCTTGTTTCTCCTTTCTCCTTTCTCGTTTTCAATCTCTCTATGA ATGGCTTCAATGTCCTCTCATGGCTCAAATGCATGGACTAAAATGCAAAACAAGACATTTGAAATGGCTTTGGCTGAATATGATCAAGACACTCCTGAACGATGGGTGAATGTTGCTAAGGCTGTTGGTGAAAAAACTGAAGAGGAAGTCAAGAGGCATTACCAACTTCTCCTTCATGATGTCAAACATATTGAGTCTGGCAATGTCCCTTTTCCCTATCCAAAGACATCGAGCAATGATGATTTGCCAAGGAAACGAGGTGTCTTGTTTCTCCTTTCTCCTTTCTCGTTTTCAATCTCTCTATGA MASMSSHGSNAWTKMQNKTFEMALAEYDQDTPERWVNVAKAVGEKTEEEVKRHYQLLLHDVKHIESGNVPFPYPKTSSNDDLPRKRGVLFLLSPFSFSISL*
BLAST of Cucsa.240590 vs. Swiss-Prot
Match: RADL1_ARATH (Protein RADIALIS-like 1 OS=Arabidopsis thaliana GN=RL1 PE=2 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.2e-22 Identity = 50/76 (65.79%), Postives = 58/76 (76.32%), Query Frame = 1
BLAST of Cucsa.240590 vs. Swiss-Prot
Match: RADL2_ARATH (Protein RADIALIS-like 2 OS=Arabidopsis thaliana GN=RL2 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.6e-22 Identity = 52/85 (61.18%), Postives = 63/85 (74.12%), Query Frame = 1
BLAST of Cucsa.240590 vs. Swiss-Prot
Match: RADL3_ARATH (Protein RADIALIS-like 3 OS=Arabidopsis thaliana GN=RL3 PE=2 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 4.2e-20 Identity = 46/80 (57.50%), Postives = 59/80 (73.75%), Query Frame = 1
BLAST of Cucsa.240590 vs. Swiss-Prot
Match: RADL5_ARATH (Protein RADIALIS-like 5 OS=Arabidopsis thaliana GN=RL5 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.7e-19 Identity = 46/76 (60.53%), Postives = 55/76 (72.37%), Query Frame = 1
BLAST of Cucsa.240590 vs. Swiss-Prot
Match: RADL6_ARATH (Protein RADIALIS-like 6 OS=Arabidopsis thaliana GN=RL6 PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 6.1e-19 Identity = 47/76 (61.84%), Postives = 55/76 (72.37%), Query Frame = 1
BLAST of Cucsa.240590 vs. TrEMBL
Match: A0A0A0K3K0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G168060 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 5.5e-27 Identity = 58/77 (75.32%), Postives = 68/77 (88.31%), Query Frame = 1
BLAST of Cucsa.240590 vs. TrEMBL
Match: A0A0A0K344_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G169070 PE=4 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 7.2e-27 Identity = 59/79 (74.68%), Postives = 66/79 (83.54%), Query Frame = 1
BLAST of Cucsa.240590 vs. TrEMBL
Match: A0A0A0K348_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G170600 PE=4 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 2.0e-24 Identity = 57/73 (78.08%), Postives = 60/73 (82.19%), Query Frame = 1
BLAST of Cucsa.240590 vs. TrEMBL
Match: A0A061E040_THECC (Homeodomain-like superfamily protein OS=Theobroma cacao GN=TCM_006883 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.3e-23 Identity = 61/105 (58.10%), Postives = 74/105 (70.48%), Query Frame = 1
BLAST of Cucsa.240590 vs. TrEMBL
Match: B9HRM8_POPTR (Myb family transcription factor family protein OS=Populus trichocarpa GN=POPTR_0009s11930g PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 6.3e-23 Identity = 55/79 (69.62%), Postives = 64/79 (81.01%), Query Frame = 1
BLAST of Cucsa.240590 vs. TAIR10
Match: AT4G39250.1 (AT4G39250.1 RAD-like 1) HSP 1 Score: 107.1 bits (266), Expect = 6.6e-24 Identity = 50/76 (65.79%), Postives = 58/76 (76.32%), Query Frame = 1
BLAST of Cucsa.240590 vs. TAIR10
Match: AT2G21650.1 (AT2G21650.1 Homeodomain-like superfamily protein) HSP 1 Score: 105.9 bits (263), Expect = 1.5e-23 Identity = 52/85 (61.18%), Postives = 63/85 (74.12%), Query Frame = 1
BLAST of Cucsa.240590 vs. TAIR10
Match: AT1G19510.1 (AT1G19510.1 RAD-like 5) HSP 1 Score: 95.9 bits (237), Expect = 1.5e-20 Identity = 46/76 (60.53%), Postives = 55/76 (72.37%), Query Frame = 1
BLAST of Cucsa.240590 vs. TAIR10
Match: AT1G75250.1 (AT1G75250.1 RAD-like 6) HSP 1 Score: 94.7 bits (234), Expect = 3.4e-20 Identity = 47/76 (61.84%), Postives = 55/76 (72.37%), Query Frame = 1
BLAST of Cucsa.240590 vs. TAIR10
Match: AT2G18328.1 (AT2G18328.1 RAD-like 4) HSP 1 Score: 89.7 bits (221), Expect = 1.1e-18 Identity = 43/72 (59.72%), Postives = 56/72 (77.78%), Query Frame = 1
BLAST of Cucsa.240590 vs. NCBI nr
Match: gi|778726246|ref|XP_011659078.1| (PREDICTED: protein RADIALIS-like 2 [Cucumis sativus]) HSP 1 Score: 179.5 bits (454), Expect = 3.0e-42 Identity = 85/87 (97.70%), Postives = 85/87 (97.70%), Query Frame = 1
BLAST of Cucsa.240590 vs. NCBI nr
Match: gi|659092931|ref|XP_008447294.1| (PREDICTED: protein RADIALIS-like 2 [Cucumis melo]) HSP 1 Score: 179.5 bits (454), Expect = 3.0e-42 Identity = 85/89 (95.51%), Postives = 87/89 (97.75%), Query Frame = 1
BLAST of Cucsa.240590 vs. NCBI nr
Match: gi|778725452|ref|XP_011658943.1| (PREDICTED: protein RADIALIS-like 1 [Cucumis sativus]) HSP 1 Score: 128.3 bits (321), Expect = 7.9e-27 Identity = 58/77 (75.32%), Postives = 68/77 (88.31%), Query Frame = 1
BLAST of Cucsa.240590 vs. NCBI nr
Match: gi|449466805|ref|XP_004151116.1| (PREDICTED: protein RADIALIS-like 1 [Cucumis sativus]) HSP 1 Score: 127.9 bits (320), Expect = 1.0e-26 Identity = 59/79 (74.68%), Postives = 66/79 (83.54%), Query Frame = 1
BLAST of Cucsa.240590 vs. NCBI nr
Match: gi|659092351|ref|XP_008447025.1| (PREDICTED: protein RADIALIS-like 1 [Cucumis melo]) HSP 1 Score: 127.5 bits (319), Expect = 1.3e-26 Identity = 59/79 (74.68%), Postives = 65/79 (82.28%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|