ClCG01G010410 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATTTCCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCGCTCCTCGCCGCCGCTCGGAAGGGCAGTCTGCTCGGCGACTGGGAGAAGATCGCCAACGTGAAGGATCCACATATTCAAGAGATCGGAGAGTTCGCGGTGGCTGAGTACAACAAGCAATCCAAAGGCGTCACAATCGAATTCAAGGACGTCGTCAGCGGCGAAAAACAGGTCGTTTCCGGTATGAACTACCGACTCGTTATCGATGCGAAGAGAGGCGAGTCGATTGGCAAATATCAGGCGTTGGTCTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTTAAGCCCGCTGCCTAA ATGAATTTCCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCGCTCCTCGCCGCCGCTCGGAAGGGCAGTCTGCTCGGCGACTGGGAGAAGATCGCCAACGTGAAGGATCCACATATTCAAGAGATCGGAGAGTTCGCGGTGGCTGAGTACAACAAGCAATCCAAAGGCGTCACAATCGAATTCAAGGACGTCGTCAGCGGCGAAAAACAGGTCGTTTCCGGTATGAACTACCGACTCGTTATCGATGCGAAGAGAGGCGAGTCGATTGGCAAATATCAGGCGTTGGTCTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTTAAGCCCGCTGCCTAA ATGAATTTCCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCGCTCCTCGCCGCCGCTCGGAAGGGCAGTCTGCTCGGCGACTGGGAGAAGATCGCCAACGTGAAGGATCCACATATTCAAGAGATCGGAGAGTTCGCGGTGGCTGAGTACAACAAGCAATCCAAAGGCGTCACAATCGAATTCAAGGACGTCGTCAGCGGCGAAAAACAGGTCGTTTCCGGTATGAACTACCGACTCGTTATCGATGCGAAGAGAGGCGAGTCGATTGGCAAATATCAGGCGTTGGTCTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTTAAGCCCGCTGCCTAA MNFRSASLFLILLLPLLAAARKGSLLGDWEKIANVKDPHIQEIGEFAVAEYNKQSKGVTIEFKDVVSGEKQVVSGMNYRLVIDAKRGESIGKYQALVWEKPWENFKKLTSFKPAA
BLAST of ClCG01G010410 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 112.5 bits (280), Expect = 3.2e-24 Identity = 57/106 (53.77%), Postives = 76/106 (71.70%), Query Frame = 1
BLAST of ClCG01G010410 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.8e-20 Identity = 51/109 (46.79%), Postives = 71/109 (65.14%), Query Frame = 1
BLAST of ClCG01G010410 vs. Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 5.8e-18 Identity = 55/117 (47.01%), Postives = 69/117 (58.97%), Query Frame = 1
BLAST of ClCG01G010410 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.4e-16 Identity = 48/103 (46.60%), Postives = 62/103 (60.19%), Query Frame = 1
BLAST of ClCG01G010410 vs. Swiss-Prot
Match: CYT7_ORYSJ (Putative cysteine proteinase inhibitor 7 OS=Oryza sativa subsp. japonica GN=Os03g0210100 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.2e-15 Identity = 46/116 (39.66%), Postives = 72/116 (62.07%), Query Frame = 1
BLAST of ClCG01G010410 vs. TrEMBL
Match: A0A0A0LTF5_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183580 PE=3 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 3.3e-44 Identity = 88/112 (78.57%), Postives = 101/112 (90.18%), Query Frame = 1
BLAST of ClCG01G010410 vs. TrEMBL
Match: A0A067GFH2_CITSI (Cysteine proteinase inhibitor OS=Citrus sinensis GN=CISIN_1g033492mg PE=3 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 2.4e-26 Identity = 65/116 (56.03%), Postives = 84/116 (72.41%), Query Frame = 1
BLAST of ClCG01G010410 vs. TrEMBL
Match: Q9FQ13_CITPA (Cysteine proteinase inhibitor OS=Citrus paradisi PE=2 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 2.4e-26 Identity = 65/116 (56.03%), Postives = 84/116 (72.41%), Query Frame = 1
BLAST of ClCG01G010410 vs. TrEMBL
Match: V4UAT4_9ROSI (Cysteine proteinase inhibitor OS=Citrus clementina GN=CICLE_v10017209mg PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 6.9e-26 Identity = 64/116 (55.17%), Postives = 84/116 (72.41%), Query Frame = 1
BLAST of ClCG01G010410 vs. TrEMBL
Match: A0A0B4ZWL9_MORAL (Cysteine proteinase inhibitor OS=Morus alba var. atropurpurea PE=2 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.2e-25 Identity = 58/105 (55.24%), Postives = 80/105 (76.19%), Query Frame = 1
BLAST of ClCG01G010410 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 112.5 bits (280), Expect = 1.8e-25 Identity = 57/106 (53.77%), Postives = 76/106 (71.70%), Query Frame = 1
BLAST of ClCG01G010410 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 73.6 bits (179), Expect = 9.2e-14 Identity = 33/82 (40.24%), Postives = 49/82 (59.76%), Query Frame = 1
BLAST of ClCG01G010410 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 71.2 bits (173), Expect = 4.6e-13 Identity = 47/116 (40.52%), Postives = 62/116 (53.45%), Query Frame = 1
BLAST of ClCG01G010410 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 66.2 bits (160), Expect = 1.5e-11 Identity = 35/96 (36.46%), Postives = 57/96 (59.38%), Query Frame = 1
BLAST of ClCG01G010410 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 64.3 bits (155), Expect = 5.6e-11 Identity = 32/83 (38.55%), Postives = 47/83 (56.63%), Query Frame = 1
BLAST of ClCG01G010410 vs. NCBI nr
Match: gi|778659769|ref|XP_011654999.1| (PREDICTED: cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 185.7 bits (470), Expect = 4.7e-44 Identity = 88/112 (78.57%), Postives = 101/112 (90.18%), Query Frame = 1
BLAST of ClCG01G010410 vs. NCBI nr
Match: gi|659127356|ref|XP_008463660.1| (PREDICTED: cysteine proteinase inhibitor 5 [Cucumis melo]) HSP 1 Score: 171.4 bits (433), Expect = 9.2e-40 Identity = 87/118 (73.73%), Postives = 98/118 (83.05%), Query Frame = 1
BLAST of ClCG01G010410 vs. NCBI nr
Match: gi|1009166880|ref|XP_015901824.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Ziziphus jujuba]) HSP 1 Score: 127.5 bits (319), Expect = 1.5e-26 Identity = 65/114 (57.02%), Postives = 79/114 (69.30%), Query Frame = 1
BLAST of ClCG01G010410 vs. NCBI nr
Match: gi|11596186|gb|AAG38521.1|AF283536_1 (cystatin-like protein [Citrus x paradisi]) HSP 1 Score: 126.3 bits (316), Expect = 3.4e-26 Identity = 65/116 (56.03%), Postives = 84/116 (72.41%), Query Frame = 1
BLAST of ClCG01G010410 vs. NCBI nr
Match: gi|568825922|ref|XP_006467325.1| (PREDICTED: multicystatin [Citrus sinensis]) HSP 1 Score: 126.3 bits (316), Expect = 3.4e-26 Identity = 65/116 (56.03%), Postives = 84/116 (72.41%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|