CmaCh13G003710 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAATCGCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCACTTCTGGTCGTCGCCACCGCTCGGATGGGGCGTCTAGTCGGCGGCTGGGAGAAGATCAAGGACGTGAAGGATCCGCATATTCAAGAGATCGGAAAGTTCGCGGTGTCTGAGTACAACAAACAATCGAAAGGCGCACTCGAATTCAAGGACGTCGTCAAAGGAGAATCGCAGGTCGTCTCCGGAATGAACTACCGCCTGGTTATCGAGGCCAAGAAAGGTGAATCGATCGGAAAATATCAGGCGTTGGTCTGGGAGAAGGCATGGCAGCATTTCATGGAACTTACGTCCTTCAAGCCCGTTGCTAATTAA ATGAAATCGCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCACTTCTGGTCGTCGCCACCGCTCGGATGGGGCGTCTAGTCGGCGGCTGGGAGAAGATCAAGGACGTGAAGGATCCGCATATTCAAGAGATCGGAAAGTTCGCGGTGTCTGAGTACAACAAACAATCGAAAGGCGCACTCGAATTCAAGGACGTCGTCAAAGGAGAATCGCAGGTCGTCTCCGGAATGAACTACCGCCTGGTTATCGAGGCCAAGAAAGGTGAATCGATCGGAAAATATCAGGCGTTGGTCTGGGAGAAGGCATGGCAGCATTTCATGGAACTTACGTCCTTCAAGCCCGTTGCTAATTAA ATGAAATCGCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCACTTCTGGTCGTCGCCACCGCTCGGATGGGGCGTCTAGTCGGCGGCTGGGAGAAGATCAAGGACGTGAAGGATCCGCATATTCAAGAGATCGGAAAGTTCGCGGTGTCTGAGTACAACAAACAATCGAAAGGCGCACTCGAATTCAAGGACGTCGTCAAAGGAGAATCGCAGGTCGTCTCCGGAATGAACTACCGCCTGGTTATCGAGGCCAAGAAAGGTGAATCGATCGGAAAATATCAGGCGTTGGTCTGGGAGAAGGCATGGCAGCATTTCATGGAACTTACGTCCTTCAAGCCCGTTGCTAATTAA MKSRSASLFLILLLPLLVVATARMGRLVGGWEKIKDVKDPHIQEIGKFAVSEYNKQSKGALEFKDVVKGESQVVSGMNYRLVIEAKKGESIGKYQALVWEKAWQHFMELTSFKPVAN
BLAST of CmaCh13G003710 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 114.8 bits (286), Expect = 6.5e-25 Identity = 58/109 (53.21%), Postives = 75/109 (68.81%), Query Frame = 1
BLAST of CmaCh13G003710 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 6.1e-23 Identity = 53/114 (46.49%), Postives = 75/114 (65.79%), Query Frame = 1
BLAST of CmaCh13G003710 vs. Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.8e-19 Identity = 55/116 (47.41%), Postives = 70/116 (60.34%), Query Frame = 1
BLAST of CmaCh13G003710 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 4.2e-16 Identity = 47/100 (47.00%), Postives = 62/100 (62.00%), Query Frame = 1
BLAST of CmaCh13G003710 vs. Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 84.3 bits (207), Expect = 9.4e-16 Identity = 39/91 (42.86%), Postives = 59/91 (64.84%), Query Frame = 1
BLAST of CmaCh13G003710 vs. TrEMBL
Match: A0A0A0LTF5_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183580 PE=3 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 3.0e-37 Identity = 80/117 (68.38%), Postives = 100/117 (85.47%), Query Frame = 1
BLAST of CmaCh13G003710 vs. TrEMBL
Match: A0A0B4ZWL9_MORAL (Cysteine proteinase inhibitor OS=Morus alba var. atropurpurea PE=2 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 2.1e-30 Identity = 67/110 (60.91%), Postives = 84/110 (76.36%), Query Frame = 1
BLAST of CmaCh13G003710 vs. TrEMBL
Match: W9R7F6_9ROSA (Cysteine proteinase inhibitor OS=Morus notabilis GN=L484_004273 PE=3 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 8.0e-30 Identity = 66/110 (60.00%), Postives = 83/110 (75.45%), Query Frame = 1
BLAST of CmaCh13G003710 vs. TrEMBL
Match: A0A0D2VC84_GOSRA (Cysteine proteinase inhibitor OS=Gossypium raimondii GN=B456_010G187500 PE=3 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 5.7e-28 Identity = 65/110 (59.09%), Postives = 83/110 (75.45%), Query Frame = 1
BLAST of CmaCh13G003710 vs. TrEMBL
Match: Q9FQ13_CITPA (Cysteine proteinase inhibitor OS=Citrus paradisi PE=2 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 1.3e-27 Identity = 66/117 (56.41%), Postives = 85/117 (72.65%), Query Frame = 1
BLAST of CmaCh13G003710 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 114.8 bits (286), Expect = 3.7e-26 Identity = 58/109 (53.21%), Postives = 75/109 (68.81%), Query Frame = 1
BLAST of CmaCh13G003710 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 78.6 bits (192), Expect = 2.9e-15 Identity = 50/115 (43.48%), Postives = 67/115 (58.26%), Query Frame = 1
BLAST of CmaCh13G003710 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 72.8 bits (177), Expect = 1.6e-13 Identity = 40/121 (33.06%), Postives = 67/121 (55.37%), Query Frame = 1
BLAST of CmaCh13G003710 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 66.2 bits (160), Expect = 1.5e-11 Identity = 34/95 (35.79%), Postives = 56/95 (58.95%), Query Frame = 1
BLAST of CmaCh13G003710 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 63.5 bits (153), Expect = 9.7e-11 Identity = 39/114 (34.21%), Postives = 59/114 (51.75%), Query Frame = 1
BLAST of CmaCh13G003710 vs. NCBI nr
Match: gi|778659769|ref|XP_011654999.1| (PREDICTED: cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 162.5 bits (410), Expect = 4.3e-37 Identity = 80/117 (68.38%), Postives = 100/117 (85.47%), Query Frame = 1
BLAST of CmaCh13G003710 vs. NCBI nr
Match: gi|659127356|ref|XP_008463660.1| (PREDICTED: cysteine proteinase inhibitor 5 [Cucumis melo]) HSP 1 Score: 147.5 bits (371), Expect = 1.4e-32 Identity = 78/120 (65.00%), Postives = 94/120 (78.33%), Query Frame = 1
BLAST of CmaCh13G003710 vs. NCBI nr
Match: gi|746657137|gb|AJD79055.1| (CPI-4 [Morus alba var. atropurpurea]) HSP 1 Score: 139.8 bits (351), Expect = 3.0e-30 Identity = 67/110 (60.91%), Postives = 84/110 (76.36%), Query Frame = 1
BLAST of CmaCh13G003710 vs. NCBI nr
Match: gi|703092669|ref|XP_010094696.1| (Cysteine proteinase inhibitor 5 [Morus notabilis]) HSP 1 Score: 137.9 bits (346), Expect = 1.1e-29 Identity = 66/110 (60.00%), Postives = 83/110 (75.45%), Query Frame = 1
BLAST of CmaCh13G003710 vs. NCBI nr
Match: gi|743888071|ref|XP_010910533.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Elaeis guineensis]) HSP 1 Score: 134.8 bits (338), Expect = 9.7e-29 Identity = 67/112 (59.82%), Postives = 85/112 (75.89%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|