CsaV3_1G017120 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGTTGAGAAGCGAGCTTTTTGGGATAGAAAGAGACTCGCCTTGTCCTTGGCCTTTGAGGCTGAGGTTGGCAAGTGGAGCTCATTTGGCCAAATAAAGTCTCTCGCCTTAGCTTTGGTTGAAATGAGTAAATTGCGCATTTTGGCTCAATGTCATCTCCCACTTCCATAGTTAATTCTAATACCGCAAAATAATCCTTTCATGATTTACTGCCATCTTAGCACACAAATAACTTAATTTGCTGATCATGCGTATCTGTCTATCCCCACGTTTACAGTCCTATTGTAGGGACAAACTTGTAATCTCCTCCCATTCATGTGCACTTATCCATTCCTATAAATATACCCACCAACCTCCTCCACCAACCCATCAAATAACGCTTCGTCAGTTTCAACCTTGATCACAATGGCTAGGTCTCTTATTTTCATGGCTTCTCTTCTCCTCTTCATTGTATCGATGTCATCCGTCGCAGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCTTAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCGGTGGAAAATTGCAGATTGTTGCTGGGACAAACTACGATCTACGATTAACTGCCCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTGTTCACTGATCTGAAGAAGCAAAACCACCTTATCCTCTTCCATGGCAGCACAAACTAAGCTTTCTCTTACATATATTTCATCAATAACTACGTGTACTAGCTAATTCTCTTTCTTTCTTTCTTCTTCTTTTTAATGGTTATTGAATGTTTGGGATCTTTGTCCTTTGCTTATTGAATAAATAGAAACATTATATTGGTGGCA ATGGCTGTTGAGAAGCGAGCTTTTTGGGATAGAAAGAGACTCGCCTTGTCCTTGGCCTTTGAGGCTGAGGTTGGCAAGTGGAGCTCATTTGGCCAAATAAAGTCTCTCGCCTTAGCTTTGGTTGAAATGATTTCAACCTTGATCACAATGGCTAGGTCTCTTATTTTCATGGCTTCTCTTCTCCTCTTCATTGTATCGATGTCATCCGTCGCAGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCTTAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCGGTGGAAAATTGCAGATTGTTGCTGGGACAAACTACGATCTACGATTAACTGCCCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTGTTCACTGATCTGAAGAAGCAAAACCACCTTATCCTCTTCCATGGCAGCACAAACTAA ATGGCTGTTGAGAAGCGAGCTTTTTGGGATAGAAAGAGACTCGCCTTGTCCTTGGCCTTTGAGGCTGAGGTTGGCAAGTGGAGCTCATTTGGCCAAATAAAGTCTCTCGCCTTAGCTTTGGTTGAAATGATTTCAACCTTGATCACAATGGCTAGGTCTCTTATTTTCATGGCTTCTCTTCTCCTCTTCATTGTATCGATGTCATCCGTCGCAGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCTTAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCGGTGGAAAATTGCAGATTGTTGCTGGGACAAACTACGATCTACGATTAACTGCCCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTGTTCACTGATCTGAAGAAGCAAAACCACCTTATCCTCTTCCATGGCAGCACAAACTAA MAVEKRAFWDRKRLALSLAFEAEVGKWSSFGQIKSLALALVEMISTLITMARSLIFMASLLLFIVSMSSVAATRAQLDLLGGYKPIKDIADPYIQSLGEFAVNEHNKQAKTELKFQKVIGGKLQIVAGTNYDLRLTALEGTVSRTYGTLVFTDLKKQNHLILFHGSTN
BLAST of CsaV3_1G017120 vs. NCBI nr
Match: XP_004151251.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus] >KGN65046.1 hypothetical protein Csa_1G183070 [Cucumis sativus]) HSP 1 Score: 204.1 bits (518), Expect = 3.6e-49 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. NCBI nr
Match: XP_022973093.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 154.1 bits (388), Expect = 4.3e-34 Identity = 76/98 (77.55%), Postives = 86/98 (87.76%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. NCBI nr
Match: XP_022975673.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 150.2 bits (378), Expect = 6.3e-33 Identity = 74/101 (73.27%), Postives = 86/101 (85.15%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. NCBI nr
Match: XP_004151250.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus] >KGN65045.1 hypothetical protein Csa_1G182070 [Cucumis sativus]) HSP 1 Score: 149.4 bits (376), Expect = 1.1e-32 Identity = 73/102 (71.57%), Postives = 88/102 (86.27%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. NCBI nr
Match: XP_023520236.1 (cysteine proteinase inhibitor 5-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 148.7 bits (374), Expect = 1.8e-32 Identity = 73/101 (72.28%), Postives = 86/101 (85.15%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 73.9 bits (180), Expect = 1.0e-13 Identity = 32/73 (43.84%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 68.9 bits (167), Expect = 3.3e-12 Identity = 28/61 (45.90%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. TAIR10
Match: AT5G12140.1 (cystatin-1) HSP 1 Score: 54.3 bits (129), Expect = 8.5e-08 Identity = 30/90 (33.33%), Postives = 49/90 (54.44%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. TAIR10
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 53.1 bits (126), Expect = 1.9e-07 Identity = 25/58 (43.10%), Postives = 37/58 (63.79%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. TAIR10
Match: AT3G12490.2 (cystatin B) HSP 1 Score: 48.1 bits (113), Expect = 6.1e-06 Identity = 24/58 (41.38%), Postives = 35/58 (60.34%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. Swiss-Prot
Match: sp|Q41916|CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 73.9 bits (180), Expect = 1.9e-12 Identity = 32/73 (43.84%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. Swiss-Prot
Match: sp|Q6TPK4|CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 1.2e-11 Identity = 32/71 (45.07%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. Swiss-Prot
Match: sp|Q84WT8|CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 68.9 bits (167), Expect = 6.0e-11 Identity = 28/61 (45.90%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. Swiss-Prot
Match: sp|Q10Q46|CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 1.0e-10 Identity = 37/85 (43.53%), Postives = 55/85 (64.71%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. Swiss-Prot
Match: sp|Q10J94|CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 7.3e-09 Identity = 28/70 (40.00%), Postives = 43/70 (61.43%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. TrEMBL
Match: tr|A0A0A0LYM0|A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 204.1 bits (518), Expect = 2.4e-49 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. TrEMBL
Match: tr|A0A0A0LT34|A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 7.1e-33 Identity = 73/102 (71.57%), Postives = 88/102 (86.27%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. TrEMBL
Match: tr|A0A2G5D4B6|A0A2G5D4B6_AQUCA (Cysteine proteinase inhibitor OS=Aquilegia coerulea OX=218851 GN=AQUCO_02800208v1 PE=3 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 2.1e-16 Identity = 44/73 (60.27%), Postives = 57/73 (78.08%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. TrEMBL
Match: tr|V4UQM2|V4UQM2_9ROSI (Cysteine proteinase inhibitor OS=Citrus clementina OX=85681 GN=CICLE_v10009506mg PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 1.1e-14 Identity = 45/95 (47.37%), Postives = 65/95 (68.42%), Query Frame = 0
BLAST of CsaV3_1G017120 vs. TrEMBL
Match: tr|A0A2H5PZ44|A0A2H5PZ44_CITUN (Cysteine proteinase inhibitor OS=Citrus unshiu OX=55188 GN=CUMW_180780 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 1.1e-14 Identity = 45/95 (47.37%), Postives = 65/95 (68.42%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|