Csa1G183580 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AAGATTTAGAAATTGAGTGATTTATAGATATTGATAGTTGAATGGTGGAGTAGCATAAATGGATGGGAGGTAATAGCATAAAGTGGTATTTTGGTGTATTTTATTGGAAGGGAAGTAAGAGAGGAGAGTTGTGAATAATGAATGGTTTGGGTAGAAGCAAGATTTGGAAGAGAAATGAAAGGTTGCTAAGGAAAGGACGAAACTCGTTTTAATCCTGTGCGATACATTTATAGTGCTCCCTCCGATTTCCGCGCCCTTTAACAACCCCTATAAATCACCCTCTTAAACCCACTCCCCAAACCAATTCCCCTAAACTCATTTCCCATTCCTTCCAACAGTTTTTAATAATCATGATTTCCCGCTCCGCTTCTCCCCTCCTCCTCCTCCTCCTCCCTCTCATCGCCGCCGCTCGCAAGGGCTCCATGCTCGGCGGCTGGTCGAAGATCCCAGACCTGAAGGATCCCCACGTTGAAGAGATCGGAAAGTTCGCGGTCGCCGAGTACAACAAGCAATCCAAAGGCGTAGCAATCGAGTTCAAAAGCGTCGTGAGCGGCGAAACTCAGGTGGTTGCTGGAACCAATTACCGCCTCCTCATCGATGCCAAGAGAGGCGAATCGATGAGCAAATATGAGGCGATAGTTTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTCAAGCCTGTTGCCTAATCAATCAGTAAAAGCCCTAAATTCACGTCTGTTTTGCTCTTAGTGTTTGGTAATTAGGAAAAATAAATTAATATTCCCTGGTAATTTCTGGACAAATCGTTTCTCTTGTCGTTTCTGGATTGATATCTCTTTGGTTATCAGATCTTTGTACTTTTATATTAAAAATATTTGTTATAAATGTCTTTGAATTTCTAAGTATTGGGATGTCTCGTCTGTATAAAAAGGGAATGCATGAACAAATATAAAATTATAAATTATAGATGCTTTTATGTATGGAAATGCTTTTGAATAATGCATTAATAAAATAAAATACTAATTTCGCTTGCAAATTGGGTTGGAAAAAGACAAAGCTATAAATGTTTATGGATATGGATCATTCAAAATCAGACCC ATGATTTCCCGCTCCGCTTCTCCCCTCCTCCTCCTCCTCCTCCCTCTCATCGCCGCCGCTCGCAAGGGCTCCATGCTCGGCGGCTGGTCGAAGATCCCAGACCTGAAGGATCCCCACGTTGAAGAGATCGGAAAGTTCGCGGTCGCCGAGTACAACAAGCAATCCAAAGGCGTAGCAATCGAGTTCAAAAGCGTCGTGAGCGGCGAAACTCAGGTGGTTGCTGGAACCAATTACCGCCTCCTCATCGATGCCAAGAGAGGCGAATCGATGAGCAAATATGAGGCGATAGTTTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTCAAGCCTGTTGCCTAA ATGATTTCCCGCTCCGCTTCTCCCCTCCTCCTCCTCCTCCTCCCTCTCATCGCCGCCGCTCGCAAGGGCTCCATGCTCGGCGGCTGGTCGAAGATCCCAGACCTGAAGGATCCCCACGTTGAAGAGATCGGAAAGTTCGCGGTCGCCGAGTACAACAAGCAATCCAAAGGCGTAGCAATCGAGTTCAAAAGCGTCGTGAGCGGCGAAACTCAGGTGGTTGCTGGAACCAATTACCGCCTCCTCATCGATGCCAAGAGAGGCGAATCGATGAGCAAATATGAGGCGATAGTTTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTCAAGCCTGTTGCCTAA MISRSASPLLLLLLPLIAAARKGSMLGGWSKIPDLKDPHVEEIGKFAVAEYNKQSKGVAIEFKSVVSGETQVVAGTNYRLLIDAKRGESMSKYEAIVWEKPWENFKKLTSFKPVA*
BLAST of Csa1G183580 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 117.5 bits (293), Expect = 9.9e-26 Identity = 60/106 (56.60%), Postives = 81/106 (76.42%), Query Frame = 1
BLAST of Csa1G183580 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.7e-23 Identity = 58/117 (49.57%), Postives = 76/117 (64.96%), Query Frame = 1
BLAST of Csa1G183580 vs. Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 9.9e-18 Identity = 50/118 (42.37%), Postives = 70/118 (59.32%), Query Frame = 1
BLAST of Csa1G183580 vs. Swiss-Prot
Match: CYT1_MAIZE (Cystatin-1 OS=Zea mays GN=RAMDAZC7 PE=2 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.7e-17 Identity = 51/125 (40.80%), Postives = 74/125 (59.20%), Query Frame = 1
BLAST of Csa1G183580 vs. Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 87.0 bits (214), Expect = 1.4e-16 Identity = 42/92 (45.65%), Postives = 60/92 (65.22%), Query Frame = 1
BLAST of Csa1G183580 vs. TrEMBL
Match: A0A0A0LTF5_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183580 PE=3 SV=1) HSP 1 Score: 228.8 bits (582), Expect = 3.4e-57 Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 1
BLAST of Csa1G183580 vs. TrEMBL
Match: A0A0B4ZWL9_MORAL (Cysteine proteinase inhibitor OS=Morus alba var. atropurpurea PE=2 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 1.0e-29 Identity = 65/107 (60.75%), Postives = 85/107 (79.44%), Query Frame = 1
BLAST of Csa1G183580 vs. TrEMBL
Match: A0A067GFH2_CITSI (Cysteine proteinase inhibitor OS=Citrus sinensis GN=CISIN_1g033492mg PE=3 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.8e-29 Identity = 67/107 (62.62%), Postives = 85/107 (79.44%), Query Frame = 1
BLAST of Csa1G183580 vs. TrEMBL
Match: Q9FQ13_CITPA (Cysteine proteinase inhibitor OS=Citrus paradisi PE=2 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.8e-29 Identity = 67/107 (62.62%), Postives = 85/107 (79.44%), Query Frame = 1
BLAST of Csa1G183580 vs. TrEMBL
Match: W9R7F6_9ROSA (Cysteine proteinase inhibitor OS=Morus notabilis GN=L484_004273 PE=3 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 3.9e-29 Identity = 64/107 (59.81%), Postives = 84/107 (78.50%), Query Frame = 1
BLAST of Csa1G183580 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 117.5 bits (293), Expect = 5.6e-27 Identity = 60/106 (56.60%), Postives = 81/106 (76.42%), Query Frame = 1
BLAST of Csa1G183580 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 80.5 bits (197), Expect = 7.6e-16 Identity = 42/98 (42.86%), Postives = 56/98 (57.14%), Query Frame = 1
BLAST of Csa1G183580 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 79.0 bits (193), Expect = 2.2e-15 Identity = 51/116 (43.97%), Postives = 65/116 (56.03%), Query Frame = 1
BLAST of Csa1G183580 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 71.6 bits (174), Expect = 3.5e-13 Identity = 39/96 (40.62%), Postives = 60/96 (62.50%), Query Frame = 1
BLAST of Csa1G183580 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 70.5 bits (171), Expect = 7.8e-13 Identity = 37/93 (39.78%), Postives = 52/93 (55.91%), Query Frame = 1
BLAST of Csa1G183580 vs. NCBI nr
Match: gi|778659769|ref|XP_011654999.1| (PREDICTED: cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 228.8 bits (582), Expect = 4.9e-57 Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 1
BLAST of Csa1G183580 vs. NCBI nr
Match: gi|659127356|ref|XP_008463660.1| (PREDICTED: cysteine proteinase inhibitor 5 [Cucumis melo]) HSP 1 Score: 180.3 bits (456), Expect = 2.0e-42 Identity = 93/118 (78.81%), Postives = 101/118 (85.59%), Query Frame = 1
BLAST of Csa1G183580 vs. NCBI nr
Match: gi|746657137|gb|AJD79055.1| (CPI-4 [Morus alba var. atropurpurea]) HSP 1 Score: 137.5 bits (345), Expect = 1.5e-29 Identity = 65/107 (60.75%), Postives = 85/107 (79.44%), Query Frame = 1
BLAST of Csa1G183580 vs. NCBI nr
Match: gi|11596186|gb|AAG38521.1|AF283536_1 (cystatin-like protein [Citrus x paradisi]) HSP 1 Score: 136.7 bits (343), Expect = 2.5e-29 Identity = 67/107 (62.62%), Postives = 85/107 (79.44%), Query Frame = 1
BLAST of Csa1G183580 vs. NCBI nr
Match: gi|568825922|ref|XP_006467325.1| (PREDICTED: multicystatin [Citrus sinensis]) HSP 1 Score: 136.7 bits (343), Expect = 2.5e-29 Identity = 67/107 (62.62%), Postives = 85/107 (79.44%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|