Cla97C01G010280 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATTTCCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCGCTCCTCGCCGCCGCTCGGAAGGGCAGTCTGCTCGGCGACTGGGAGAAGATCGCCAACGTGAAGGATCCACATATTCAAGAGATCGGAGAGTTCGCGGTGGCTGAGTACAACAAGCAATCCAAAGGCGTCACAATCGAATTCAAGGACGTCGTCAGCGGCGAAAAACAGGTCGTTTCCGGTATGAACTACCGACTCGTTATCGATGCGAAGAGAGGCGAGTCGATTGGCAAATATCAGGCGTTGGTCTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTTAAGCCCGCTGCCTAA ATGAATTTCCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCGCTCCTCGCCGCCGCTCGGAAGGGCAGTCTGCTCGGCGACTGGGAGAAGATCGCCAACGTGAAGGATCCACATATTCAAGAGATCGGAGAGTTCGCGGTGGCTGAGTACAACAAGCAATCCAAAGGCGTCACAATCGAATTCAAGGACGTCGTCAGCGGCGAAAAACAGGTCGTTTCCGGTATGAACTACCGACTCGTTATCGATGCGAAGAGAGGCGAGTCGATTGGCAAATATCAGGCGTTGGTCTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTTAAGCCCGCTGCCTAA ATGAATTTCCGCTCCGCTTCTCTCTTCCTCATCCTTCTCCTCCCGCTCCTCGCCGCCGCTCGGAAGGGCAGTCTGCTCGGCGACTGGGAGAAGATCGCCAACGTGAAGGATCCACATATTCAAGAGATCGGAGAGTTCGCGGTGGCTGAGTACAACAAGCAATCCAAAGGCGTCACAATCGAATTCAAGGACGTCGTCAGCGGCGAAAAACAGGTCGTTTCCGGTATGAACTACCGACTCGTTATCGATGCGAAGAGAGGCGAGTCGATTGGCAAATATCAGGCGTTGGTCTGGGAGAAGCCATGGGAGAATTTCAAGAAACTTACATCCTTTAAGCCCGCTGCCTAA MNFRSASLFLILLLPLLAAARKGSLLGDWEKIANVKDPHIQEIGEFAVAEYNKQSKGVTIEFKDVVSGEKQVVSGMNYRLVIDAKRGESIGKYQALVWEKPWENFKKLTSFKPAA
BLAST of Cla97C01G010280 vs. NCBI nr
Match: XP_011654999.1 (PREDICTED: cysteine proteinase inhibitor 5 [Cucumis sativus] >KGN65048.1 Cystatin-like protein [Cucumis sativus]) HSP 1 Score: 184.9 bits (468), Expect = 1.6e-43 Identity = 88/112 (78.57%), Postives = 101/112 (90.18%), Query Frame = 0
BLAST of Cla97C01G010280 vs. NCBI nr
Match: XP_022973098.1 (cysteine proteinase inhibitor 5-like [Cucurbita maxima]) HSP 1 Score: 176.4 bits (446), Expect = 5.5e-41 Identity = 91/117 (77.78%), Postives = 101/117 (86.32%), Query Frame = 0
BLAST of Cla97C01G010280 vs. NCBI nr
Match: XP_022927193.1 (cysteine proteinase inhibitor 5-like [Cucurbita moschata]) HSP 1 Score: 176.0 bits (445), Expect = 7.2e-41 Identity = 90/117 (76.92%), Postives = 101/117 (86.32%), Query Frame = 0
BLAST of Cla97C01G010280 vs. NCBI nr
Match: XP_023520814.1 (cysteine proteinase inhibitor 5-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 174.1 bits (440), Expect = 2.8e-40 Identity = 90/117 (76.92%), Postives = 100/117 (85.47%), Query Frame = 0
BLAST of Cla97C01G010280 vs. NCBI nr
Match: XP_008463660.1 (PREDICTED: cysteine proteinase inhibitor 5 [Cucumis melo]) HSP 1 Score: 170.6 bits (431), Expect = 3.0e-39 Identity = 87/118 (73.73%), Postives = 98/118 (83.05%), Query Frame = 0
BLAST of Cla97C01G010280 vs. TrEMBL
Match: tr|A0A0A0LTF5|A0A0A0LTF5_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G183580 PE=3 SV=1) HSP 1 Score: 184.9 bits (468), Expect = 1.0e-43 Identity = 88/112 (78.57%), Postives = 101/112 (90.18%), Query Frame = 0
BLAST of Cla97C01G010280 vs. TrEMBL
Match: tr|A0A1S3CJR9|A0A1S3CJR9_CUCME (Cysteine proteinase inhibitor OS=Cucumis melo OX=3656 GN=LOC103501752 PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 2.0e-39 Identity = 87/118 (73.73%), Postives = 98/118 (83.05%), Query Frame = 0
BLAST of Cla97C01G010280 vs. TrEMBL
Match: tr|A0A2I4G446|A0A2I4G446_9ROSI (Cysteine proteinase inhibitor OS=Juglans regia OX=51240 GN=LOC109004561 PE=3 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 3.6e-28 Identity = 67/108 (62.04%), Postives = 82/108 (75.93%), Query Frame = 0
BLAST of Cla97C01G010280 vs. TrEMBL
Match: tr|A0A2N9F1M1|A0A2N9F1M1_FAGSY (Cysteine proteinase inhibitor OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS8895 PE=3 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 7.4e-26 Identity = 61/110 (55.45%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of Cla97C01G010280 vs. TrEMBL
Match: tr|Q9FQ13|Q9FQ13_CITPA (Cysteine proteinase inhibitor OS=Citrus paradisi OX=37656 PE=2 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 9.7e-26 Identity = 65/116 (56.03%), Postives = 84/116 (72.41%), Query Frame = 0
BLAST of Cla97C01G010280 vs. Swiss-Prot
Match: sp|Q41916|CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 111.7 bits (278), Expect = 5.5e-24 Identity = 57/106 (53.77%), Postives = 78/106 (73.58%), Query Frame = 0
BLAST of Cla97C01G010280 vs. Swiss-Prot
Match: sp|Q6TPK4|CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 6.3e-20 Identity = 51/109 (46.79%), Postives = 72/109 (66.06%), Query Frame = 0
BLAST of Cla97C01G010280 vs. Swiss-Prot
Match: sp|Q10J94|CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.3e-17 Identity = 55/117 (47.01%), Postives = 71/117 (60.68%), Query Frame = 0
BLAST of Cla97C01G010280 vs. Swiss-Prot
Match: sp|Q10Q46|CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.1e-16 Identity = 46/100 (46.00%), Postives = 60/100 (60.00%), Query Frame = 0
BLAST of Cla97C01G010280 vs. Swiss-Prot
Match: sp|P09229|CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 82.8 bits (203), Expect = 2.7e-15 Identity = 39/91 (42.86%), Postives = 60/91 (65.93%), Query Frame = 0
BLAST of Cla97C01G010280 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 111.7 bits (278), Expect = 3.0e-25 Identity = 57/106 (53.77%), Postives = 78/106 (73.58%), Query Frame = 0
BLAST of Cla97C01G010280 vs. TAIR10
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 73.6 bits (179), Expect = 9.2e-14 Identity = 33/82 (40.24%), Postives = 50/82 (60.98%), Query Frame = 0
BLAST of Cla97C01G010280 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 70.1 bits (170), Expect = 1.0e-12 Identity = 47/116 (40.52%), Postives = 64/116 (55.17%), Query Frame = 0
BLAST of Cla97C01G010280 vs. TAIR10
Match: AT5G12140.1 (cystatin-1) HSP 1 Score: 67.0 bits (162), Expect = 8.6e-12 Identity = 35/96 (36.46%), Postives = 59/96 (61.46%), Query Frame = 0
BLAST of Cla97C01G010280 vs. TAIR10
Match: AT3G12490.2 (cystatin B) HSP 1 Score: 64.3 bits (155), Expect = 5.6e-11 Identity = 32/83 (38.55%), Postives = 48/83 (57.83%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|