Cp4.1LG09g06390 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAATCCTACTCCGCTTCACTCTTCCTCGTCCTTCTCCTCCCGATCCTAGCCATCGCTCAAAACGAGAATCAAGTCGGCTCTTGGAAGCCGATTGCAGACGTGGATGATCCGCACATTCAAGAGATCGGAAAGTTCGCTGTGAAAGAGAACAATTTGGAATCCAAAAACAACTTCGTATACAAGAGGGTCGTTAGCGGCGAATCACAGGTCGCCTCTGGAATCAACTACCACCTCGTTATCGAAGTCAAGGATGGAAGTTTGGATGCGCAATATCAGGCCGTCGTGTTGGAGAAGAAATGGGAGCATTCCAAGCAGCTCGTGTCCTTCAACCCTCTCTCCTAA ATGAAATCCTACTCCGCTTCACTCTTCCTCGTCCTTCTCCTCCCGATCCTAGCCATCGCTCAAAACGAGAATCAAGTCGGCTCTTGGAAGCCGATTGCAGACGTGGATGATCCGCACATTCAAGAGATCGGAAAGTTCGCTGTGAAAGAGAACAATTTGGAATCCAAAAACAACTTCGTATACAAGAGGGTCGTTAGCGGCGAATCACAGGTCGCCTCTGGAATCAACTACCACCTCGTTATCGAAGTCAAGGATGGAAGTTTGGATGCGCAATATCAGGCCGTCGTGTTGGAGAAGAAATGGGAGCATTCCAAGCAGCTCGTGTCCTTCAACCCTCTCTCCTAA ATGAAATCCTACTCCGCTTCACTCTTCCTCGTCCTTCTCCTCCCGATCCTAGCCATCGCTCAAAACGAGAATCAAGTCGGCTCTTGGAAGCCGATTGCAGACGTGGATGATCCGCACATTCAAGAGATCGGAAAGTTCGCTGTGAAAGAGAACAATTTGGAATCCAAAAACAACTTCGTATACAAGAGGGTCGTTAGCGGCGAATCACAGGTCGCCTCTGGAATCAACTACCACCTCGTTATCGAAGTCAAGGATGGAAGTTTGGATGCGCAATATCAGGCCGTCGTGTTGGAGAAGAAATGGGAGCATTCCAAGCAGCTCGTGTCCTTCAACCCTCTCTCCTAA MKSYSASLFLVLLLPILAIAQNENQVGSWKPIADVDDPHIQEIGKFAVKENNLESKNNFVYKRVVSGESQVASGINYHLVIEVKDGSLDAQYQAVVLEKKWEHSKQLVSFNPLS
BLAST of Cp4.1LG09g06390 vs. Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 6.3e-17 Identity = 51/114 (44.74%), Postives = 67/114 (58.77%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 86.3 bits (212), Expect = 2.4e-16 Identity = 46/104 (44.23%), Postives = 64/104 (61.54%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 85.1 bits (209), Expect = 5.4e-16 Identity = 46/107 (42.99%), Postives = 67/107 (62.62%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.6e-15 Identity = 39/86 (45.35%), Postives = 57/86 (66.28%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.0e-15 Identity = 42/107 (39.25%), Postives = 64/107 (59.81%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. TrEMBL
Match: A0A0A0LTF5_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183580 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 3.5e-22 Identity = 57/115 (49.57%), Postives = 81/115 (70.43%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. TrEMBL
Match: A0A059CB44_EUCGR (Cysteine proteinase inhibitor OS=Eucalyptus grandis GN=EUGRSUZ_E03921 PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 4.7e-19 Identity = 49/106 (46.23%), Postives = 72/106 (67.92%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. TrEMBL
Match: A0A0B4ZWL9_MORAL (Cysteine proteinase inhibitor OS=Morus alba var. atropurpurea PE=2 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.3e-18 Identity = 49/112 (43.75%), Postives = 70/112 (62.50%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. TrEMBL
Match: R0GSM6_9BRAS (Cysteine proteinase inhibitor (Fragment) OS=Capsella rubella GN=CARUB_v10027345mg PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 4.0e-18 Identity = 49/108 (45.37%), Postives = 69/108 (63.89%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. TrEMBL
Match: Q9FQ13_CITPA (Cysteine proteinase inhibitor OS=Citrus paradisi PE=2 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 4.0e-18 Identity = 48/102 (47.06%), Postives = 66/102 (64.71%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 86.3 bits (212), Expect = 1.4e-17 Identity = 46/104 (44.23%), Postives = 64/104 (61.54%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 85.1 bits (209), Expect = 3.0e-17 Identity = 46/107 (42.99%), Postives = 67/107 (62.62%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 71.6 bits (174), Expect = 3.5e-13 Identity = 34/81 (41.98%), Postives = 51/81 (62.96%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. NCBI nr
Match: gi|778659769|ref|XP_011654999.1| (PREDICTED: cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 112.5 bits (280), Expect = 5.0e-22 Identity = 57/115 (49.57%), Postives = 81/115 (70.43%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. NCBI nr
Match: gi|1009166880|ref|XP_015901824.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Ziziphus jujuba]) HSP 1 Score: 108.2 bits (269), Expect = 9.5e-21 Identity = 53/114 (46.49%), Postives = 79/114 (69.30%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. NCBI nr
Match: gi|672182168|ref|XP_008811323.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Phoenix dactylifera]) HSP 1 Score: 105.1 bits (261), Expect = 8.0e-20 Identity = 55/116 (47.41%), Postives = 70/116 (60.34%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. NCBI nr
Match: gi|743888071|ref|XP_010910533.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Elaeis guineensis]) HSP 1 Score: 103.6 bits (257), Expect = 2.3e-19 Identity = 50/112 (44.64%), Postives = 74/112 (66.07%), Query Frame = 1
BLAST of Cp4.1LG09g06390 vs. NCBI nr
Match: gi|702351327|ref|XP_010057839.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Eucalyptus grandis]) HSP 1 Score: 102.1 bits (253), Expect = 6.8e-19 Identity = 49/106 (46.23%), Postives = 72/106 (67.92%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|