Csa1G182070 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGGGTCTTTTTGTTTCCTGGCTTCTGTTCTCGTCTTCGTTGCATCAATGTCATCGATCGCAACGGCAACATCACGGTTAGATTTGGTCGGTGACTACAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCCTAGGAGAGTTCGCAGTGAAGGAGCACAATAAGGAAGCCAAAACAGAATTGAAATTCAAAGAAGTGATTAGTGGAAAATTACAGATTGTTGCTGGGACCAACTACGAGCTTCAGTTAACGGCTCTCGAGGGGAGTATTATAAACATAATTTATGAGACTCTTGTATTCACAGATCTGAAGAACGAGAACCACCTTATCAAATTCTATTCCATTTCTAACTAA ATGGCTGGGTCTTTTTGTTTCCTGGCTTCTGTTCTCGTCTTCGTTGCATCAATGTCATCGATCGCAACGGCAACATCACGGTTAGATTTGGTCGGTGACTACAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCCTAGGAGAGTTCGCAGTGAAGGAGCACAATAAGGAAGCCAAAACAGAATTGAAATTCAAAGAAGTGATTAGTGGAAAATTACAGATTGTTGCTGGGACCAACTACGAGCTTCAGTTAACGGCTCTCGAGGGGAGTATTATAAACATAATTTATGAGACTCTTGTATTCACAGATCTGAAGAACGAGAACCACCTTATCAAATTCTATTCCATTTCTAACTAA ATGGCTGGGTCTTTTTGTTTCCTGGCTTCTGTTCTCGTCTTCGTTGCATCAATGTCATCGATCGCAACGGCAACATCACGGTTAGATTTGGTCGGTGACTACAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCCTAGGAGAGTTCGCAGTGAAGGAGCACAATAAGGAAGCCAAAACAGAATTGAAATTCAAAGAAGTGATTAGTGGAAAATTACAGATTGTTGCTGGGACCAACTACGAGCTTCAGTTAACGGCTCTCGAGGGGAGTATTATAAACATAATTTATGAGACTCTTGTATTCACAGATCTGAAGAACGAGAACCACCTTATCAAATTCTATTCCATTTCTAACTAA MAGSFCFLASVLVFVASMSSIATATSRLDLVGDYKPIKDIADPYIQSLGEFAVKEHNKEAKTELKFKEVISGKLQIVAGTNYELQLTALEGSIINIIYETLVFTDLKNENHLIKFYSISN*
BLAST of Csa1G182070 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 75.5 bits (184), Expect = 4.5e-13 Identity = 38/103 (36.89%), Postives = 62/103 (60.19%), Query Frame = 1
BLAST of Csa1G182070 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 33/96 (34.38%), Postives = 58/96 (60.42%), Query Frame = 1
BLAST of Csa1G182070 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 66.6 bits (161), Expect = 2.1e-10 Identity = 30/76 (39.47%), Postives = 50/76 (65.79%), Query Frame = 1
BLAST of Csa1G182070 vs. Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 6.7e-09 Identity = 30/75 (40.00%), Postives = 46/75 (61.33%), Query Frame = 1
BLAST of Csa1G182070 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 2.2e-07 Identity = 35/98 (35.71%), Postives = 52/98 (53.06%), Query Frame = 1
BLAST of Csa1G182070 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 233.4 bits (594), Expect = 1.4e-58 Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 1
BLAST of Csa1G182070 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 2.8e-38 Identity = 83/120 (69.17%), Postives = 102/120 (85.00%), Query Frame = 1
BLAST of Csa1G182070 vs. TrEMBL
Match: A5B2E1_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VITISV_013491 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.4e-13 Identity = 43/99 (43.43%), Postives = 64/99 (64.65%), Query Frame = 1
BLAST of Csa1G182070 vs. TrEMBL
Match: F6HRK8_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VIT_00s0187g00040 PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 3.1e-13 Identity = 43/99 (43.43%), Postives = 64/99 (64.65%), Query Frame = 1
BLAST of Csa1G182070 vs. TrEMBL
Match: A0A0K9RVP8_SPIOL (Cysteine proteinase inhibitor OS=Spinacia oleracea GN=SOVF_029630 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 7.0e-13 Identity = 41/95 (43.16%), Postives = 64/95 (67.37%), Query Frame = 1
BLAST of Csa1G182070 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 75.5 bits (184), Expect = 2.5e-14 Identity = 38/103 (36.89%), Postives = 62/103 (60.19%), Query Frame = 1
BLAST of Csa1G182070 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 66.6 bits (161), Expect = 1.2e-11 Identity = 30/76 (39.47%), Postives = 50/76 (65.79%), Query Frame = 1
BLAST of Csa1G182070 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 51.6 bits (122), Expect = 3.9e-07 Identity = 23/47 (48.94%), Postives = 31/47 (65.96%), Query Frame = 1
BLAST of Csa1G182070 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 49.3 bits (116), Expect = 2.0e-06 Identity = 32/91 (35.16%), Postives = 45/91 (49.45%), Query Frame = 1
BLAST of Csa1G182070 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 47.0 bits (110), Expect = 9.7e-06 Identity = 30/89 (33.71%), Postives = 44/89 (49.44%), Query Frame = 1
BLAST of Csa1G182070 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 233.4 bits (594), Expect = 2.1e-58 Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 1
BLAST of Csa1G182070 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 166.0 bits (419), Expect = 4.1e-38 Identity = 83/120 (69.17%), Postives = 102/120 (85.00%), Query Frame = 1
BLAST of Csa1G182070 vs. NCBI nr
Match: gi|147854421|emb|CAN82794.1| (hypothetical protein VITISV_013491 [Vitis vinifera]) HSP 1 Score: 83.2 bits (204), Expect = 3.5e-13 Identity = 43/99 (43.43%), Postives = 64/99 (64.65%), Query Frame = 1
BLAST of Csa1G182070 vs. NCBI nr
Match: gi|297741794|emb|CBI33099.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 82.8 bits (203), Expect = 4.5e-13 Identity = 43/99 (43.43%), Postives = 64/99 (64.65%), Query Frame = 1
BLAST of Csa1G182070 vs. NCBI nr
Match: gi|359495539|ref|XP_003635016.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Vitis vinifera]) HSP 1 Score: 82.8 bits (203), Expect = 4.5e-13 Identity = 43/99 (43.43%), Postives = 64/99 (64.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|