ClCG01G010440 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGTCGGTCACAGCAACAAGGTCACGGTTAGATTTGGTCGGTGGCTATGAACCAATAAAGAGCATAGATGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGTCTGGGACCAACTACGACCTTCGATTAATGGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCTAACTAA ATGTTGTCGGTCACAGCAACAAGGTCACGGTTAGATTTGGTCGGTGGCTATGAACCAATAAAGAGCATAGATGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGTCTGGGACCAACTACGACCTTCGATTAATGGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCTAACTAA ATGTTGTCGGTCACAGCAACAAGGTCACGGTTAGATTTGGTCGGTGGCTATGAACCAATAAAGAGCATAGATGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGTCTGGGACCAACTACGACCTTCGATTAATGGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCTAACTAA MLSVTATRSRLDLVGGYEPIKSIDDPHIQSLGEFAVNEHNKQAKTQLKFEKVISGKLQIVSGTNYDLRLMALEGTVSRTYGTLVFTDLKNENHLINFYGLSN
BLAST of ClCG01G010440 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 77.8 bits (190), Expect = 7.7e-14 Identity = 36/73 (49.32%), Postives = 54/73 (73.97%), Query Frame = 1
BLAST of ClCG01G010440 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.2e-11 Identity = 31/76 (40.79%), Postives = 49/76 (64.47%), Query Frame = 1
BLAST of ClCG01G010440 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.2e-11 Identity = 41/100 (41.00%), Postives = 59/100 (59.00%), Query Frame = 1
BLAST of ClCG01G010440 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 67.4 bits (163), Expect = 1.0e-10 Identity = 27/61 (44.26%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of ClCG01G010440 vs. Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 2.0e-09 Identity = 30/73 (41.10%), Postives = 45/73 (61.64%), Query Frame = 1
BLAST of ClCG01G010440 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 8.2e-39 Identity = 82/102 (80.39%), Postives = 93/102 (91.18%), Query Frame = 1
BLAST of ClCG01G010440 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 2.0e-32 Identity = 73/103 (70.87%), Postives = 87/103 (84.47%), Query Frame = 1
BLAST of ClCG01G010440 vs. TrEMBL
Match: F6HRK8_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VIT_00s0187g00040 PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 4.8e-15 Identity = 41/73 (56.16%), Postives = 54/73 (73.97%), Query Frame = 1
BLAST of ClCG01G010440 vs. TrEMBL
Match: V4UQM2_9ROSI (Cysteine proteinase inhibitor OS=Citrus clementina GN=CICLE_v10009506mg PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 4.8e-15 Identity = 43/100 (43.00%), Postives = 66/100 (66.00%), Query Frame = 1
BLAST of ClCG01G010440 vs. TrEMBL
Match: A0A067EPU7_CITSI (Cysteine proteinase inhibitor OS=Citrus sinensis GN=CISIN_1g037584mg PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 4.8e-15 Identity = 43/100 (43.00%), Postives = 66/100 (66.00%), Query Frame = 1
BLAST of ClCG01G010440 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 77.8 bits (190), Expect = 4.3e-15 Identity = 36/73 (49.32%), Postives = 54/73 (73.97%), Query Frame = 1
BLAST of ClCG01G010440 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 67.4 bits (163), Expect = 5.8e-12 Identity = 27/61 (44.26%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of ClCG01G010440 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 52.8 bits (125), Expect = 1.5e-07 Identity = 26/74 (35.14%), Postives = 42/74 (56.76%), Query Frame = 1
BLAST of ClCG01G010440 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 51.2 bits (121), Expect = 4.3e-07 Identity = 28/90 (31.11%), Postives = 47/90 (52.22%), Query Frame = 1
BLAST of ClCG01G010440 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 48.9 bits (115), Expect = 2.1e-06 Identity = 27/74 (36.49%), Postives = 40/74 (54.05%), Query Frame = 1
BLAST of ClCG01G010440 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 167.5 bits (423), Expect = 1.2e-38 Identity = 82/102 (80.39%), Postives = 93/102 (91.18%), Query Frame = 1
BLAST of ClCG01G010440 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 146.4 bits (368), Expect = 2.8e-32 Identity = 73/103 (70.87%), Postives = 87/103 (84.47%), Query Frame = 1
BLAST of ClCG01G010440 vs. NCBI nr
Match: gi|297741794|emb|CBI33099.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 88.6 bits (218), Expect = 6.9e-15 Identity = 41/73 (56.16%), Postives = 54/73 (73.97%), Query Frame = 1
BLAST of ClCG01G010440 vs. NCBI nr
Match: gi|567919020|ref|XP_006451516.1| (hypothetical protein CICLE_v10009506mg [Citrus clementina]) HSP 1 Score: 88.6 bits (218), Expect = 6.9e-15 Identity = 43/100 (43.00%), Postives = 66/100 (66.00%), Query Frame = 1
BLAST of ClCG01G010440 vs. NCBI nr
Match: gi|359495539|ref|XP_003635016.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Vitis vinifera]) HSP 1 Score: 88.6 bits (218), Expect = 6.9e-15 Identity = 41/73 (56.16%), Postives = 54/73 (73.97%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|