Lsi02G011150 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCTCTTCTCCTCTTCGTCATATCGCTGTCGTCGGTCGCAGCGACAAGGTCACGATTAGATTTAGTTGGTGGCTACGAACCGATAAAGAACATAGCTGATCCACACATCCAAAGTTTAGGAGAGTTTGCAGTGAATGAACACAATAAGAAAGCCAAAACTCAACTTAAATTTGAAAAAGTAATTGGTGGAAAATTACAGATTGTGGCTAGAACCAATTACAACCTTCAATTAACAGTTCTTGAAGGGAGTGTAAGCAGAACCTATGGGACTCTTGTATTCACTGATCTGAAGAATGAGAACCACCTTATCTACTTCTTTGGCATCTCCAACTAA ATGGCTTCTCTTCTCCTCTTCGTCATATCGCTGTCGTCGGTCGCAGCGACAAGGTCACGATTAGATTTAGTTGGTGGCTACGAACCGATAAAGAACATAGCTGATCCACACATCCAAAGTTTAGGAGAGTTTGCAGTGAATGAACACAATAAGAAAGCCAAAACTCAACTTAAATTTGAAAAAGTAATTGGTGGAAAATTACAGATTGTGGCTAGAACCAATTACAACCTTCAATTAACAGTTCTTGAAGGGAGTGTAAGCAGAACCTATGGGACTCTTGTATTCACTGATCTGAAGAATGAGAACCACCTTATCTACTTCTTTGGCATCTCCAACTAA ATGGCTTCTCTTCTCCTCTTCGTCATATCGCTGTCGTCGGTCGCAGCGACAAGGTCACGATTAGATTTAGTTGGTGGCTACGAACCGATAAAGAACATAGCTGATCCACACATCCAAAGTTTAGGAGAGTTTGCAGTGAATGAACACAATAAGAAAGCCAAAACTCAACTTAAATTTGAAAAAGTAATTGGTGGAAAATTACAGATTGTGGCTAGAACCAATTACAACCTTCAATTAACAGTTCTTGAAGGGAGTGTAAGCAGAACCTATGGGACTCTTGTATTCACTGATCTGAAGAATGAGAACCACCTTATCTACTTCTTTGGCATCTCCAACTAA MASLLLFVISLSSVAATRSRLDLVGGYEPIKNIADPHIQSLGEFAVNEHNKKAKTQLKFEKVIGGKLQIVARTNYNLQLTVLEGSVSRTYGTLVFTDLKNENHLIYFFGISN
BLAST of Lsi02G011150 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 75.5 bits (184), Expect = 4.2e-13 Identity = 39/96 (40.62%), Postives = 65/96 (67.71%), Query Frame = 1
BLAST of Lsi02G011150 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 3.0e-11 Identity = 35/94 (37.23%), Postives = 60/94 (63.83%), Query Frame = 1
BLAST of Lsi02G011150 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 1.1e-10 Identity = 39/98 (39.80%), Postives = 59/98 (60.20%), Query Frame = 1
BLAST of Lsi02G011150 vs. Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 64.3 bits (155), Expect = 9.6e-10 Identity = 32/73 (43.84%), Postives = 44/73 (60.27%), Query Frame = 1
BLAST of Lsi02G011150 vs. Swiss-Prot
Match: CYT1_MAIZE (Cystatin-1 OS=Zea mays GN=RAMDAZC7 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 6.2e-09 Identity = 39/105 (37.14%), Postives = 59/105 (56.19%), Query Frame = 1
BLAST of Lsi02G011150 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 1.7e-42 Identity = 89/112 (79.46%), Postives = 106/112 (94.64%), Query Frame = 1
BLAST of Lsi02G011150 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 1.2e-35 Identity = 82/113 (72.57%), Postives = 97/113 (85.84%), Query Frame = 1
BLAST of Lsi02G011150 vs. TrEMBL
Match: A0A103Y1R1_CYNCS (Cysteine proteinase inhibitor OS=Cynara cardunculus var. scolymus GN=Ccrd_020815 PE=3 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 5.9e-14 Identity = 48/107 (44.86%), Postives = 66/107 (61.68%), Query Frame = 1
BLAST of Lsi02G011150 vs. TrEMBL
Match: R0GSM6_9BRAS (Cysteine proteinase inhibitor (Fragment) OS=Capsella rubella GN=CARUB_v10027345mg PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.3e-13 Identity = 41/94 (43.62%), Postives = 63/94 (67.02%), Query Frame = 1
BLAST of Lsi02G011150 vs. TrEMBL
Match: F6HRK8_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VIT_00s0187g00040 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.2e-13 Identity = 37/73 (50.68%), Postives = 51/73 (69.86%), Query Frame = 1
BLAST of Lsi02G011150 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 75.5 bits (184), Expect = 2.4e-14 Identity = 39/96 (40.62%), Postives = 65/96 (67.71%), Query Frame = 1
BLAST of Lsi02G011150 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 59.7 bits (143), Expect = 1.3e-09 Identity = 29/81 (35.80%), Postives = 51/81 (62.96%), Query Frame = 1
BLAST of Lsi02G011150 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 55.5 bits (132), Expect = 2.5e-08 Identity = 31/90 (34.44%), Postives = 50/90 (55.56%), Query Frame = 1
BLAST of Lsi02G011150 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 54.7 bits (130), Expect = 4.3e-08 Identity = 36/96 (37.50%), Postives = 52/96 (54.17%), Query Frame = 1
BLAST of Lsi02G011150 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 47.4 bits (111), Expect = 6.9e-06 Identity = 28/95 (29.47%), Postives = 48/95 (50.53%), Query Frame = 1
BLAST of Lsi02G011150 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 179.9 bits (455), Expect = 2.5e-42 Identity = 89/112 (79.46%), Postives = 106/112 (94.64%), Query Frame = 1
BLAST of Lsi02G011150 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 157.1 bits (396), Expect = 1.7e-35 Identity = 82/113 (72.57%), Postives = 97/113 (85.84%), Query Frame = 1
BLAST of Lsi02G011150 vs. NCBI nr
Match: gi|976914912|gb|KVI00924.1| (Cystatin [Cynara cardunculus var. scolymus]) HSP 1 Score: 85.1 bits (209), Expect = 8.4e-14 Identity = 48/107 (44.86%), Postives = 66/107 (61.68%), Query Frame = 1
BLAST of Lsi02G011150 vs. NCBI nr
Match: gi|1009166880|ref|XP_015901824.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Ziziphus jujuba]) HSP 1 Score: 84.0 bits (206), Expect = 1.9e-13 Identity = 40/92 (43.48%), Postives = 61/92 (66.30%), Query Frame = 1
BLAST of Lsi02G011150 vs. NCBI nr
Match: gi|565435455|ref|XP_006281295.1| (hypothetical protein CARUB_v10027345mg, partial [Capsella rubella]) HSP 1 Score: 84.0 bits (206), Expect = 1.9e-13 Identity = 41/94 (43.62%), Postives = 63/94 (67.02%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |