Cucsa.180420 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATTTGGTCGGTGACTACAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCCTAGGAGAGTTCGCAGTGAAGGAGCACAATAAGGAAGCCAAAACAGAATTGAAATTCAAAGAAGTGATTAGTGGAAAATTACAGATTGTTGCTGGGACCAACTACGAGCTTCAGTTAACGGCTCTCGAGGGGAGTATTATAAACATAATTTATGAGACTCTTGTATTCACAGATCTGAAGAACGAGAACCACCTTATCAAATTCTATTCCATTTCTAACTAA ATTTGGTCGGTGACTACAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCCTAGGAGAGTTCGCAGTGAAGGAGCACAATAAGGAAGCCAAAACAGAATTGAAATTCAAAGAAGTGATTAGTGGAAAATTACAGATTGTTGCTGGGACCAACTACGAGCTTCAGTTAACGGCTCTCGAGGGGAATCTGAAGAACGAGAACCACCTTATCAAATTCTATTCCATTTCTAACTAA ATTTGGTCGGTGACTACAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCCTAGGAGAGTTCGCAGTGAAGGAGCACAATAAGGAAGCCAAAACAGAATTGAAATTCAAAGAAGTGATTAGTGGAAAATTACAGATTGTTGCTGGGACCAACTACGAGCTTCAGTTAACGGCTCTCGAGGGGAATCTGAAGAACGAGAACCACCTTATCAAATTCTATTCCATTTCTAACTAA LVGDYKPIKDIADPYIQSLGEFAVKEHNKEAKTELKFKEVISGKLQIVAGTNYELQLTALEGNLKNENHLIKFYSISN*
BLAST of Cucsa.180420 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 73.2 bits (178), Expect = 1.5e-12 Identity = 31/69 (44.93%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Cucsa.180420 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 3.6e-11 Identity = 28/68 (41.18%), Postives = 51/68 (75.00%), Query Frame = 1
BLAST of Cucsa.180420 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.4e-09 Identity = 26/60 (43.33%), Postives = 41/60 (68.33%), Query Frame = 1
BLAST of Cucsa.180420 vs. Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.2e-08 Identity = 27/59 (45.76%), Postives = 40/59 (67.80%), Query Frame = 1
BLAST of Cucsa.180420 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.1e-07 Identity = 26/59 (44.07%), Postives = 40/59 (67.80%), Query Frame = 1
BLAST of Cucsa.180420 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 2.0e-32 Identity = 77/91 (84.62%), Postives = 78/91 (85.71%), Query Frame = 1
BLAST of Cucsa.180420 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.6e-24 Identity = 61/90 (67.78%), Postives = 71/90 (78.89%), Query Frame = 1
BLAST of Cucsa.180420 vs. TrEMBL
Match: A5B2E1_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VITISV_013491 PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 6.0e-13 Identity = 35/67 (52.24%), Postives = 51/67 (76.12%), Query Frame = 1
BLAST of Cucsa.180420 vs. TrEMBL
Match: F6HRK8_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VIT_00s0187g00040 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 7.8e-13 Identity = 35/67 (52.24%), Postives = 51/67 (76.12%), Query Frame = 1
BLAST of Cucsa.180420 vs. TrEMBL
Match: A0A0K9RVP8_SPIOL (Cysteine proteinase inhibitor OS=Spinacia oleracea GN=SOVF_029630 PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 8.6e-12 Identity = 33/59 (55.93%), Postives = 46/59 (77.97%), Query Frame = 1
BLAST of Cucsa.180420 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 73.2 bits (178), Expect = 8.2e-14 Identity = 31/69 (44.93%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Cucsa.180420 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 68.6 bits (166), Expect = 2.0e-12 Identity = 28/68 (41.18%), Postives = 51/68 (75.00%), Query Frame = 1
BLAST of Cucsa.180420 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 52.0 bits (123), Expect = 2.0e-07 Identity = 23/48 (47.92%), Postives = 34/48 (70.83%), Query Frame = 1
BLAST of Cucsa.180420 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 46.6 bits (109), Expect = 8.3e-06 Identity = 23/50 (46.00%), Postives = 30/50 (60.00%), Query Frame = 1
BLAST of Cucsa.180420 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 146.0 bits (367), Expect = 2.8e-32 Identity = 77/91 (84.62%), Postives = 78/91 (85.71%), Query Frame = 1
BLAST of Cucsa.180420 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 119.0 bits (297), Expect = 3.7e-24 Identity = 61/90 (67.78%), Postives = 71/90 (78.89%), Query Frame = 1
BLAST of Cucsa.180420 vs. NCBI nr
Match: gi|147854421|emb|CAN82794.1| (hypothetical protein VITISV_013491 [Vitis vinifera]) HSP 1 Score: 81.3 bits (199), Expect = 8.6e-13 Identity = 35/67 (52.24%), Postives = 51/67 (76.12%), Query Frame = 1
BLAST of Cucsa.180420 vs. NCBI nr
Match: gi|359495539|ref|XP_003635016.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Vitis vinifera]) HSP 1 Score: 80.9 bits (198), Expect = 1.1e-12 Identity = 35/67 (52.24%), Postives = 51/67 (76.12%), Query Frame = 1
BLAST of Cucsa.180420 vs. NCBI nr
Match: gi|297741794|emb|CBI33099.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 80.9 bits (198), Expect = 1.1e-12 Identity = 35/67 (52.24%), Postives = 51/67 (76.12%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|