CsGy1G015540 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAGGTCTCTTATTTTCATGGCTTCTCTTCTCCTCTTCATTGTATCGATGTCATCCGTCGCAGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCTTAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCGGTGGAAAATTGCAGATTGTTGCTGGGACAAACTACGATCTACGATTAACTGCCCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTGTTCACTGATCTGAAGAAGCAAAACCACCTTATCCTCTTCCATGGCAGCACAAACTAA ATGGCTAGGTCTCTTATTTTCATGGCTTCTCTTCTCCTCTTCATTGTATCGATGTCATCCGTCGCAGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCTTAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCGGTGGAAAATTGCAGATTGTTGCTGGGACAAACTACGATCTACGATTAACTGCCCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTGTTCACTGATCTGAAGAAGCAAAACCACCTTATCCTCTTCCATGGCAGCACAAACTAA ATGGCTAGGTCTCTTATTTTCATGGCTTCTCTTCTCCTCTTCATTGTATCGATGTCATCCGTCGCAGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCTTAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCGGTGGAAAATTGCAGATTGTTGCTGGGACAAACTACGATCTACGATTAACTGCCCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTGTTCACTGATCTGAAGAAGCAAAACCACCTTATCCTCTTCCATGGCAGCACAAACTAA MARSLIFMASLLLFIVSMSSVAATRAQLDLLGGYKPIKDIADPYIQSLGEFAVNEHNKQAKTELKFQKVIGGKLQIVAGTNYDLRLTALEGTVSRTYGTLVFTDLKKQNHLILFHGSTN
BLAST of CsGy1G015540 vs. NCBI nr
Match: XP_004151251.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus] >KGN65046.1 hypothetical protein Csa_1G183070 [Cucumis sativus]) HSP 1 Score: 228.8 bits (582), Expect = 9.7e-57 Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 0
BLAST of CsGy1G015540 vs. NCBI nr
Match: XP_022975673.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 164.9 bits (416), Expect = 1.7e-37 Identity = 84/119 (70.59%), Postives = 102/119 (85.71%), Query Frame = 0
BLAST of CsGy1G015540 vs. NCBI nr
Match: XP_022973093.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 164.1 bits (414), Expect = 2.9e-37 Identity = 83/116 (71.55%), Postives = 100/116 (86.21%), Query Frame = 0
BLAST of CsGy1G015540 vs. NCBI nr
Match: XP_004151250.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus] >KGN65045.1 hypothetical protein Csa_1G182070 [Cucumis sativus]) HSP 1 Score: 162.5 bits (410), Expect = 8.6e-37 Identity = 83/120 (69.17%), Postives = 102/120 (85.00%), Query Frame = 0
BLAST of CsGy1G015540 vs. NCBI nr
Match: XP_023520236.1 (cysteine proteinase inhibitor 5-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 162.5 bits (410), Expect = 8.6e-37 Identity = 82/119 (68.91%), Postives = 102/119 (85.71%), Query Frame = 0
BLAST of CsGy1G015540 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 75.9 bits (185), Expect = 1.9e-14 Identity = 39/103 (37.86%), Postives = 69/103 (66.99%), Query Frame = 0
BLAST of CsGy1G015540 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 68.2 bits (165), Expect = 4.0e-12 Identity = 36/91 (39.56%), Postives = 60/91 (65.93%), Query Frame = 0
BLAST of CsGy1G015540 vs. TAIR10
Match: AT5G12140.1 (cystatin-1) HSP 1 Score: 53.9 bits (128), Expect = 7.8e-08 Identity = 30/90 (33.33%), Postives = 49/90 (54.44%), Query Frame = 0
BLAST of CsGy1G015540 vs. TAIR10
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 52.8 bits (125), Expect = 1.7e-07 Identity = 25/58 (43.10%), Postives = 37/58 (63.79%), Query Frame = 0
BLAST of CsGy1G015540 vs. TAIR10
Match: AT3G12490.2 (cystatin B) HSP 1 Score: 49.7 bits (117), Expect = 1.5e-06 Identity = 37/106 (34.91%), Postives = 58/106 (54.72%), Query Frame = 0
BLAST of CsGy1G015540 vs. Swiss-Prot
Match: sp|Q41916|CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 75.9 bits (185), Expect = 3.5e-13 Identity = 39/103 (37.86%), Postives = 69/103 (66.99%), Query Frame = 0
BLAST of CsGy1G015540 vs. Swiss-Prot
Match: sp|Q6TPK4|CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 5.9e-13 Identity = 39/94 (41.49%), Postives = 61/94 (64.89%), Query Frame = 0
BLAST of CsGy1G015540 vs. Swiss-Prot
Match: sp|Q84WT8|CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 7.2e-11 Identity = 36/91 (39.56%), Postives = 60/91 (65.93%), Query Frame = 0
BLAST of CsGy1G015540 vs. Swiss-Prot
Match: sp|Q10Q46|CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 1.2e-10 Identity = 37/85 (43.53%), Postives = 55/85 (64.71%), Query Frame = 0
BLAST of CsGy1G015540 vs. Swiss-Prot
Match: sp|Q10J94|CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.5e-08 Identity = 34/89 (38.20%), Postives = 53/89 (59.55%), Query Frame = 0
BLAST of CsGy1G015540 vs. TrEMBL
Match: tr|A0A0A0LYM0|A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 228.8 bits (582), Expect = 6.4e-57 Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 0
BLAST of CsGy1G015540 vs. TrEMBL
Match: tr|A0A0A0LT34|A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 5.7e-37 Identity = 83/120 (69.17%), Postives = 102/120 (85.00%), Query Frame = 0
BLAST of CsGy1G015540 vs. TrEMBL
Match: tr|A0A2G5D4B6|A0A2G5D4B6_AQUCA (Cysteine proteinase inhibitor OS=Aquilegia coerulea OX=218851 GN=AQUCO_02800208v1 PE=3 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 3.2e-16 Identity = 50/98 (51.02%), Postives = 69/98 (70.41%), Query Frame = 0
BLAST of CsGy1G015540 vs. TrEMBL
Match: tr|V4UQM2|V4UQM2_9ROSI (Cysteine proteinase inhibitor OS=Citrus clementina OX=85681 GN=CICLE_v10009506mg PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 6.1e-15 Identity = 45/105 (42.86%), Postives = 67/105 (63.81%), Query Frame = 0
BLAST of CsGy1G015540 vs. TrEMBL
Match: tr|A0A2H5PZ44|A0A2H5PZ44_CITUN (Cysteine proteinase inhibitor OS=Citrus unshiu OX=55188 GN=CUMW_180780 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 6.1e-15 Identity = 45/105 (42.86%), Postives = 67/105 (63.81%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |