MELO3C025554 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCTCTTCTCCTCTTCGTCGTATCAATGTCATCCATCACCGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCATAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCAGTGGAAAATTTCAGATTGTTGCTGGGACAAACTACCATCTACGATTAACGGCGCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTATTCACTGATCTGAAGAAGGAAAACCACCTTATCTTATTCTATGGCATCACAAACTAA ATGGCTTCTCTTCTCCTCTTCGTCGTATCAATGTCATCCATCACCGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCATAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCAGTGGAAAATTTCAGATTGTTGCTGGGACAAACTACCATCTACGATTAACGGCGCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTATTCACTGATCTGAAGAAGGAAAACCACCTTATCTTATTCTATGGCATCACAAACTAA ATGGCTTCTCTTCTCCTCTTCGTCGTATCAATGTCATCCATCACCGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCATAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCAGTGGAAAATTTCAGATTGTTGCTGGGACAAACTACCATCTACGATTAACGGCGCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTATTCACTGATCTGAAGAAGGAAAACCACCTTATCTTATTCTATGGCATCACAAACTAA MASLLLFVVSMSSITATRAQLDLLGGYKPIKDIADPYIQSIGEFAVNEHNKQAKTELKFQKVISGKFQIVAGTNYHLRLTALEGTVSRTYGTLVFTDLKKENHLILFYGITN*
BLAST of MELO3C025554 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.1e-13 Identity = 39/94 (41.49%), Postives = 59/94 (62.77%), Query Frame = 1
BLAST of MELO3C025554 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 77.0 bits (188), Expect = 1.4e-13 Identity = 38/96 (39.58%), Postives = 65/96 (67.71%), Query Frame = 1
BLAST of MELO3C025554 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 66.6 bits (161), Expect = 2.0e-10 Identity = 27/61 (44.26%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of MELO3C025554 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.2e-09 Identity = 34/85 (40.00%), Postives = 51/85 (60.00%), Query Frame = 1
BLAST of MELO3C025554 vs. Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 6.3e-09 Identity = 31/83 (37.35%), Postives = 49/83 (59.04%), Query Frame = 1
BLAST of MELO3C025554 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 204.5 bits (519), Expect = 6.7e-50 Identity = 102/112 (91.07%), Postives = 107/112 (95.54%), Query Frame = 1
BLAST of MELO3C025554 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 2.2e-37 Identity = 82/113 (72.57%), Postives = 97/113 (85.84%), Query Frame = 1
BLAST of MELO3C025554 vs. TrEMBL
Match: A0A067EPU7_CITSI (Cysteine proteinase inhibitor OS=Citrus sinensis GN=CISIN_1g037584mg PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 6.3e-16 Identity = 46/105 (43.81%), Postives = 68/105 (64.76%), Query Frame = 1
BLAST of MELO3C025554 vs. TrEMBL
Match: V4UQM2_9ROSI (Cysteine proteinase inhibitor OS=Citrus clementina GN=CICLE_v10009506mg PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 6.3e-16 Identity = 46/105 (43.81%), Postives = 68/105 (64.76%), Query Frame = 1
BLAST of MELO3C025554 vs. TrEMBL
Match: A5B2E1_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VITISV_013491 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 2.4e-15 Identity = 42/73 (57.53%), Postives = 55/73 (75.34%), Query Frame = 1
BLAST of MELO3C025554 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 77.0 bits (188), Expect = 8.2e-15 Identity = 38/96 (39.58%), Postives = 65/96 (67.71%), Query Frame = 1
BLAST of MELO3C025554 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 66.6 bits (161), Expect = 1.1e-11 Identity = 27/61 (44.26%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of MELO3C025554 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 56.2 bits (134), Expect = 1.5e-08 Identity = 25/58 (43.10%), Postives = 36/58 (62.07%), Query Frame = 1
BLAST of MELO3C025554 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 53.9 bits (128), Expect = 7.4e-08 Identity = 33/96 (34.38%), Postives = 51/96 (53.12%), Query Frame = 1
BLAST of MELO3C025554 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 53.1 bits (126), Expect = 1.3e-07 Identity = 29/90 (32.22%), Postives = 47/90 (52.22%), Query Frame = 1
BLAST of MELO3C025554 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 204.5 bits (519), Expect = 9.6e-50 Identity = 102/112 (91.07%), Postives = 107/112 (95.54%), Query Frame = 1
BLAST of MELO3C025554 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 162.9 bits (411), Expect = 3.2e-37 Identity = 82/113 (72.57%), Postives = 97/113 (85.84%), Query Frame = 1
BLAST of MELO3C025554 vs. NCBI nr
Match: gi|568843169|ref|XP_006475490.1| (PREDICTED: cysteine proteinase inhibitor 5 [Citrus sinensis]) HSP 1 Score: 91.7 bits (226), Expect = 9.1e-16 Identity = 46/105 (43.81%), Postives = 68/105 (64.76%), Query Frame = 1
BLAST of MELO3C025554 vs. NCBI nr
Match: gi|567919020|ref|XP_006451516.1| (hypothetical protein CICLE_v10009506mg [Citrus clementina]) HSP 1 Score: 91.7 bits (226), Expect = 9.1e-16 Identity = 46/105 (43.81%), Postives = 68/105 (64.76%), Query Frame = 1
BLAST of MELO3C025554 vs. NCBI nr
Match: gi|147854421|emb|CAN82794.1| (hypothetical protein VITISV_013491 [Vitis vinifera]) HSP 1 Score: 89.7 bits (221), Expect = 3.4e-15 Identity = 42/73 (57.53%), Postives = 55/73 (75.34%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|