Csa1G183070 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAGGTCTCTTATTTTCATGGCTTCTCTTCTCCTCTTCATTGTATCGATGTCATCCGTCGCAGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCTTAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCGGTGGAAAATTGCAGATTGTTGCTGGGACAAACTACGATCTACGATTAACTGCCCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTGTTCACTGATCTGAAGAAGCAAAACCACCTTATCCTCTTCCATGGCAGCACAAACTAA ATGGCTAGGTCTCTTATTTTCATGGCTTCTCTTCTCCTCTTCATTGTATCGATGTCATCCGTCGCAGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCTTAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCGGTGGAAAATTGCAGATTGTTGCTGGGACAAACTACGATCTACGATTAACTGCCCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTGTTCACTGATCTGAAGAAGCAAAACCACCTTATCCTCTTCCATGGCAGCACAAACTAA ATGGCTAGGTCTCTTATTTTCATGGCTTCTCTTCTCCTCTTCATTGTATCGATGTCATCCGTCGCAGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCTTAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCGGTGGAAAATTGCAGATTGTTGCTGGGACAAACTACGATCTACGATTAACTGCCCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTGTTCACTGATCTGAAGAAGCAAAACCACCTTATCCTCTTCCATGGCAGCACAAACTAA MARSLIFMASLLLFIVSMSSVAATRAQLDLLGGYKPIKDIADPYIQSLGEFAVNEHNKQAKTELKFQKVIGGKLQIVAGTNYDLRLTALEGTVSRTYGTLVFTDLKKQNHLILFHGSTN*
BLAST of Csa1G183070 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 79.3 bits (194), Expect = 3.1e-14 Identity = 39/103 (37.86%), Postives = 67/103 (65.05%), Query Frame = 1
BLAST of Csa1G183070 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.0e-13 Identity = 39/94 (41.49%), Postives = 59/94 (62.77%), Query Frame = 1
BLAST of Csa1G183070 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 71.2 bits (173), Expect = 8.4e-12 Identity = 36/91 (39.56%), Postives = 58/91 (63.74%), Query Frame = 1
BLAST of Csa1G183070 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.6e-10 Identity = 37/85 (43.53%), Postives = 53/85 (62.35%), Query Frame = 1
BLAST of Csa1G183070 vs. Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.3e-09 Identity = 34/89 (38.20%), Postives = 51/89 (57.30%), Query Frame = 1
BLAST of Csa1G183070 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 232.3 bits (591), Expect = 3.2e-58 Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 1
BLAST of Csa1G183070 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 2.8e-38 Identity = 83/120 (69.17%), Postives = 102/120 (85.00%), Query Frame = 1
BLAST of Csa1G183070 vs. TrEMBL
Match: V4UQM2_9ROSI (Cysteine proteinase inhibitor OS=Citrus clementina GN=CICLE_v10009506mg PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.1e-15 Identity = 45/105 (42.86%), Postives = 67/105 (63.81%), Query Frame = 1
BLAST of Csa1G183070 vs. TrEMBL
Match: A0A067EPU7_CITSI (Cysteine proteinase inhibitor OS=Citrus sinensis GN=CISIN_1g037584mg PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.1e-15 Identity = 45/105 (42.86%), Postives = 67/105 (63.81%), Query Frame = 1
BLAST of Csa1G183070 vs. TrEMBL
Match: A5B2E1_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VITISV_013491 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 3.3e-15 Identity = 47/100 (47.00%), Postives = 67/100 (67.00%), Query Frame = 1
BLAST of Csa1G183070 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 79.3 bits (194), Expect = 1.7e-15 Identity = 39/103 (37.86%), Postives = 67/103 (65.05%), Query Frame = 1
BLAST of Csa1G183070 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 71.2 bits (173), Expect = 4.8e-13 Identity = 36/91 (39.56%), Postives = 58/91 (63.74%), Query Frame = 1
BLAST of Csa1G183070 vs. TAIR10
Match: AT5G12140.1 (AT5G12140.1 cystatin-1) HSP 1 Score: 53.1 bits (126), Expect = 1.3e-07 Identity = 30/90 (33.33%), Postives = 47/90 (52.22%), Query Frame = 1
BLAST of Csa1G183070 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 52.8 bits (125), Expect = 1.7e-07 Identity = 25/58 (43.10%), Postives = 35/58 (60.34%), Query Frame = 1
BLAST of Csa1G183070 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 52.8 bits (125), Expect = 1.7e-07 Identity = 37/106 (34.91%), Postives = 56/106 (52.83%), Query Frame = 1
BLAST of Csa1G183070 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 232.3 bits (591), Expect = 4.6e-58 Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 1
BLAST of Csa1G183070 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 166.0 bits (419), Expect = 4.0e-38 Identity = 83/120 (69.17%), Postives = 102/120 (85.00%), Query Frame = 1
BLAST of Csa1G183070 vs. NCBI nr
Match: gi|567919020|ref|XP_006451516.1| (hypothetical protein CICLE_v10009506mg [Citrus clementina]) HSP 1 Score: 90.9 bits (224), Expect = 1.6e-15 Identity = 45/105 (42.86%), Postives = 67/105 (63.81%), Query Frame = 1
BLAST of Csa1G183070 vs. NCBI nr
Match: gi|568843169|ref|XP_006475490.1| (PREDICTED: cysteine proteinase inhibitor 5 [Citrus sinensis]) HSP 1 Score: 90.9 bits (224), Expect = 1.6e-15 Identity = 45/105 (42.86%), Postives = 67/105 (63.81%), Query Frame = 1
BLAST of Csa1G183070 vs. NCBI nr
Match: gi|147854421|emb|CAN82794.1| (hypothetical protein VITISV_013491 [Vitis vinifera]) HSP 1 Score: 89.4 bits (220), Expect = 4.8e-15 Identity = 47/100 (47.00%), Postives = 67/100 (67.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|